SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG04609 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG04609
Domain Number 1 Region: 149-257
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-23
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 2 Region: 269-371
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-21
Family Spermadhesin, CUB domain 0.0029
Further Details:      
 
Domain Number 3 Region: 3-147
Classification Level Classification E-value
Superfamily C-type lectin-like 7.35e-20
Family C-type lectin domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG04609   Protein: CBP32023   Gene: WBGene00027248
Sequence length 372
Comment CBP32023 WBGene00027248 status:Predicted UniProt:A8WY19
Sequence
MIFLILFLLLFSAISPDNECPYRYKFYANTAICYHLSDDFYDFNGAVRYCESTGGKLVSL
IQGERAGIANLTSHLLVQPWVASKRNTTTGIFYNLDHSVFISEQWAQGEPNPANGDCVTF
KGVSSNFGLQTTQCYQQQYAFCKIVPDLCNGGIQNGTFGSIQSPQYPNQYYNKLMCLYYI
YAPQGFRVNIYFPQIQTEKNYDFIEIYEKNSTLYPDRIVGLSGNITDYTYQSNSSFLLVG
FRTNYVFTDIGFHATWNVERIQPPIISNTTNYGELTSPNYPEDYDTFDKQLYYIQVVEGG
RINVTIDDFFTQETFDYLDIFDSSNQSSKVVRLSGNSVAPWSWLSTSSVVLLKFVSDGSY
QYRGWHLTWNMI
Download sequence
Identical sequences A8WY19
6238.CBG04609 CBG04609

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]