SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG04732 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CBG04732
Domain Number - Region: 29-119
Classification Level Classification E-value
Superfamily Immunoglobulin 0.016
Family I set domains 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG04732   Protein: CBP06803   Gene: WBGene00027349
Sequence length 137
Comment CBP06803 WBGene00027349 status:Predicted UniProt:A8WYC2
Sequence
MYRVAGLVALLALYIQAIEFEEGDNINVPSTLYIKVGANATIGLPVSANYRREIRTCTTT
CNYDEQLYRVCNGKNKKTCGYWESVKTKKKVASGKTTYNKNKKSLIIRNMKESDFGKYMT
GNKKKSRYVEQLVSFGK
Download sequence
Identical sequences A8WYC2
XP_002637921.1.8413 6238.CBG04732 CBG04732

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]