SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG05053 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG05053
Domain Number 1 Region: 68-152
Classification Level Classification E-value
Superfamily Immunoglobulin 5.73e-17
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 161-253
Classification Level Classification E-value
Superfamily Immunoglobulin 1.06e-16
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 246-330
Classification Level Classification E-value
Superfamily Immunoglobulin 1.99e-16
Family I set domains 0.012
Further Details:      
 
Domain Number 4 Region: 392-474
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000063
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 5 Region: 334-390
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000312
Family I set domains 0.024
Further Details:      
 
Domain Number 6 Region: 21-74
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000661
Family I set domains 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG05053   Protein: CBP25790   Gene: WBGene00027604
Sequence length 757
Comment CBP25790 WBGene00027604 locus:Cbr-igcm-2 status:Predicted UniProt:A8WZ25
Sequence
MLVCFFFDLVTFLSYLSNEIRRLARDGFLGITIHSVTDADAGVYQCVVTKFSKQPTKPEK
GLSAKLVVNVPPEISVPTNHQVIHRTIGSDLALECKADGAPSPEITWSRNDQIISTSPVL
TLSNLSGSDGGYYTCLAVNIEGNHTSSIDLRFSKATSLDLVPLNKTVIEGSNVFWHCHAN
SQATSISYSWFFEKKPIKTTPLGLRSNIRSGDLSLLDVRKSDSGWYTCEAKNPTGETTSS
TAYLQVFYPPEPSETHQPVKTVASGRNATVSCDITANPKPTSYTWTKNGHFLPSQISVPQ
AKSEIFIVHAKPGDGGIYGCQADNIAGKGSIVETHVIVAEPPVFTVLPPSKIKVRLGDDV
TIPCQGFGDPMPIVYWVRDKVTSKTCNDVKIDVTKPQMATGLKFTCLNSSSMRISWIPGY
NGGFDQTFAVHAQNDMNLQWTSIKTSRNETILDHLEPFVSYRVSIESVNAKGSTNSTTYN
RRSNFFRFFFFRRKFLIAGCTSLHAPDKLYICGYNELCWTAAEGASSYRIESRTEPSKNF
QPLAEVIETYYRLGKDVDETKQTVFRVRSSRPSYPPSEPSNSLRLGLAENADLSIFIIVA
VFGLFFIFACGWFAWRCFNNKNKKAKRRKSQSTSTPSKTYQDYGRFTYGDATTSSQPSTE
TYYEPSLRLLDEHEWRGPRDLEPVAVRYPPVTITFYIENKNLIFQSLAELDYDIGEENPI
DDMFRDRYILGVQDPPAQLYQDLRLERLRREYKQSQI
Download sequence
Identical sequences A8WZ25
6238.CBG05053 CBG05053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]