SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG05054 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG05054
Domain Number 1 Region: 117-203
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000011
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 2 Region: 233-311
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000187
Family I set domains 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG05054   Protein: CBP15238   Gene: WBGene00027605
Sequence length 533
Comment CBP15238 WBGene00027605 status:Predicted UniProt:A8WZ26
Sequence
MLYETTICKDLGVPEDCYKHLCNPTVLPDILNRHIVFEKRLNCGRYIVPITKCLTQGRDV
GTCCLEEDHQEMYKDCYGMCNGTVDNYGDYLREDFLMCFVSNVPTIFPCLLEGYKYSPTP
PRNLELVSKTNHSAKFIWDEPAEFADSLDHYRIHLTQRTGQYGTGKYFITKERNFTLEGL
ISNFAYTVHVVAHAGEYKNNSDWYKSGVSNLVLFNIGPQLAVSKNELLMPNSTKTVILFC
QLKLISYAERSLEWVKTIGDETIVLESTEKYSIKIYQPEHRLLKDTILSALKINDFDEND
FGSYRCYIKNTRIEYYETNVTLWDHSEQTPATNPPETLLECCSKNVEKEHCRTICTKGVA
NKKAMIRPEHIIPPFHSCKEELNQLLKCTHDGLNAVPCCVHHELPYSCLGLCNEQFPMEK
RDVRWFCKDHYKTIYKCKLEAMDNTPEGLGDVRPLHIWGWTFRFSWDKVEGAKVYHVYTR
RKEGKWKVRVTLDNTVDVTRQDEAVIIAVNEFGQSLPYRLYYDINGWEPVDHW
Download sequence
Identical sequences A8WZ26
CBG05054 6238.CBG05054 XP_002644876.1.8413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]