SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG05359 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG05359
Domain Number 1 Region: 27-184
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-31
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 2 Region: 226-337
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.19e-27
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 3 Region: 1308-1454
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.59e-21
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.023
Further Details:      
 
Domain Number 4 Region: 353-449
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-21
Family Spermadhesin, CUB domain 0.0029
Further Details:      
 
Domain Number 5 Region: 1055-1119
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000229
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 6 Region: 457-567
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000262
Family Spermadhesin, CUB domain 0.0023
Further Details:      
 
Domain Number 7 Region: 709-771
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000189
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 8 Region: 651-715
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000473
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 9 Region: 177-218
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000012
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 10 Region: 1190-1263
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000208
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number 11 Region: 1890-2028
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000816
Family Growth factor receptor domain 0.0088
Further Details:      
 
Domain Number 12 Region: 2100-2140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000976
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 13 Region: 2138-2182
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family EGF-type module 0.024
Further Details:      
 
Domain Number 14 Region: 589-662
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000032
Family Complement control module/SCR domain 0.0039
Further Details:      
 
Domain Number 15 Region: 2063-2103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000156
Family EGF-type module 0.039
Further Details:      
 
Domain Number 16 Region: 981-1022
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000251
Family EGF-type module 0.013
Further Details:      
 
Domain Number 17 Region: 2181-2215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000858
Family EGF-type module 0.01
Further Details:      
 
Weak hits

Sequence:  CBG05359
Domain Number - Region: 1673-1713
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0422
Family Complement control module/SCR domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG05359   Protein: CBP28522   Gene: WBGene00027820
Sequence length 2226
Comment CBP28522 WBGene00027820 locus:Cbr-clec-78 status:Partially_confirmed UniProt:A8WZP0
Sequence
MHENCRKRRLLTEVVFVVLLLLIEPTQSSSSSSKFTPPSQVTDVELKCPDEWIRLGTKCY
LPFNIHQSWPFALTTCQRYGSTLAKIQTGSENQFIANLLSKPGGKMGEIKEYWIGLTVEV
LDDDELYIWSDGTPTSRYVGFWRQDQPNFLNGTCAMGRVERKDLEWRLETCNLLRRFVCE
RPACVQGSYFCSSGSCISESKKCNGFNDCDDGSDEQNCPSAFQPACRTYEKGESGQLSSP
NYPNSYDPNLNCRYVLEGPVNSRIELTIEHFETEPVFDVLTVLDGGPAENSTTVIKRLSG
SFETAQTITSSTNMMIVQFRSDAQSNARGFQLKWRAIPFSCGGHYIAQAYIQPFVSPGYP
KTFANGAECVWTVETTPGQVISLILDDFSLGAEDNLIIYNGPTPSATVLASFSGNLTTKK
YVTSSTSHIYIYMMTRQNSNSRGFSISYKRGCDLSMSDVLGEIISPGYLSSEYPNDVQCT
YTIETEDQKADRSISLIAQRFDLADGDTVRVFENSVSKGKALHENDGFGLKTKPEKQIDS
NSNRIQMVFKSGSSRQAMGFNFSYSIVTAQQTKSLKLSIIPIPNLLFPDCPAFPSVPMVT
LSTKQRSVSTRVTVSCPIGFEFASGEGISKTVVCLMGGKWSQSHISTCQPIYCGAVPQIA
NGYVDSATNVSFGGQVKYSCHKGFFFSSGKDIETVYCGELGKWNTPPPCKAATCQPLTQF
TNGERRLEFGDGTGYGSVFRYDCHSGYRREGVESLLCKSDGTWSSKQPSCTSELKILFIP
VFGLVFFVKSLAHISQKSRMPESRFPIDSYLVTSLVSSATLASQLTDLKRYCSFSDFQNF
QKTMSSDPLPGQSDCLLNPQLMCLESQPIETGSSNFCPDPKSTDKKIKVLKFAIPMIVEQ
IRFTNQRNGKIQKISVKYSESNKSRTKKLQIDNQSIFGVDDDDVATLPMALEVQVLEIEA
VGMEGTPCVEVEALGCQRTSCADINECLKNNGHCDHLCINTQGSYKVRGIFWCACRNGYD
LFMENGQSGVNVSAGETGNNVNDLIRFEKSCVPRQCEHIGSPENGQLLSTAKNFEFPMIV
QFQCDFGYQMMGPDYIQCLADGTWNGTEPFCLPATCQGIEQLPSKSDGLHVTPNNSTITF
GQNVSISCTLPNRPGRPNSALFSYRQCIFDPKDDGRDYWLSGPPPECSFIECPAPPTMPG
AVYVGDVTDRKMGSTLEFTCRQPYTVAGRSDRTIKCSSDATWDLGDLRCEGPVCVDPGYP
YDGQVSLFVGIVELESVEEGAIARFSCKRPGFVPFPSDTLQCALGASCVLSEDVGIVSGF
VPDGAFSDNSDSTNLGYEPHHARMGSSGWCGAKEDFIFLSVDLQRVYTLTTLRIAGVAGS
GHLKGHVTKFQLFYKTQNQNKYEPYPVEFESPAGNHNAMHHFDLKFSLRARYILFGVTEY
EGNPCMKFDLMGCVAPVFAAHEVDSHLQIGWNGSVPQCVDMDPPKFENCPESEIFAKVDE
NGQLKAVEFEEPVASDNSGKIAYTQIEPLGMRSGLMITSDMDITYTAYDSAGNTAVCTLK
IRIPDTQPPVMKCPDSYTIPVGNSTKHVIFDMTTVDLVLHDTSNVSEVTFSPTEATLKIG
EFVEVTAQAEDENGNRNSCKFQVAYAPEACSPASLASSNHIVKNCVHEDGAVVCSVYCAQ
GYRFIDPDQITQNFVCKDGRWSPRNNAPACVPIPKDPAGFHVNVGMTYPVLSPVPDHCLK
GYAELAAKEFDNLDKVLSARCSSSVEVFVRLLKLDFSNLNGQLIGNYTIQVLPTEQQSVF
YDLCGLTLRTIFDLNIPGANQPIQSLLSLSGESIASQTAGCPSITAKGSSIVQGFACGTG
EVLRQEAKDRLPECSKYFVGNFCRKFQGLSNHMPFFLVACPSGSVNINNTCILCPRGSYQ
DDSGQTSCKPCPDGTYTLDEGSQSVASCLSTCGYGMYSTTGLIPCQLCPRHTFSGPAPVG
GFRDCEACPSGAYTAKLGASSATECRLACKTGSYSNTGLEPCSPCPINFYQPALGQQSCL
ECSNATATQGSGESLESACFPIDCSAKMCENNADCSVFMHRAQCHCKPGYVGDRCEIVED
VCATQPCYNGGKCEQVGTTYKCTCPKMFSGARCQFESDECVGKTCPNGGVCHDLPGLKST
TCLCRTGFAGPNCEEITDICSTNNPCRNGARCIGEKLGRFKCQCVPGWEGPTCDNNIGEG
KKFGRS
Download sequence
Identical sequences A8WZP0
6238.CBG05359 CBG05359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]