SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG05858 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG05858
Domain Number 1 Region: 85-243,300-371
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.61e-37
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 1111-1304,1339-1363
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.39e-34
Family Voltage-gated potassium channels 0.014
Further Details:      
 
Domain Number 3 Region: 793-947,987-1064
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-31
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 4 Region: 467-701
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 9.42e-31
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  CBG05858
Domain Number - Region: 1370-1449
Classification Level Classification E-value
Superfamily EF-hand 0.00443
Family Calmodulin-like 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG05858   Protein: CBP01613   Gene: WBGene00028228
Sequence length 1780
Comment CBP01613 WBGene00028228 locus:Cbr-egl-19 status:Predicted UniProt:A8X1H0
Sequence
LASMMSSGEDEEQAAADEQERSDLWQQTLQAAVAASSSQDATKKRPAQRKPLRQTNVVER
SERSLLCLSLNNPIRKLCISIVEWKPFEFLILFMICANCIALAIYQPYPAQDSDYKNTLL
ETIEYVFIVVFTIECVLKIVAMGFLFHPSAYLRNAWNILDFIIVVIGLVSTILSKMSIQG
FDVKALRAFRVLRPLRLVSGVPSLQVVLNAILRAMIPLLHIALLVLFVILIYAIIGLELF
CGKLHSTCIDPATGQLAQKDPTPCGNDGSAFKCRPSDSLTNMGVRWECSSNTTWPGPNNG
ITNFDNFGLAMLTVFQCVSLEGWTDVMYWVNDAVGREWPWIYFVTLVILGSFFVLNLVLG
VLSGEFSKEREKARARGLFQKFREKQQLEEDLKGYLDWITQAEDIEPVNEDEQEDEPAAA
AVTGEEVDEEGEERVEDVRPSKWSARVKRLEKFNRRCRRACRRLVKSQTFYWLVILLVLL
NTLVLTSEHYGQSEWLDHFQTMANLFFVILFSMEMLLKMYSLGFTTYTTSQFNRFDCFVV
ISSILEFVLVYFDLMKPLGVSVLRSARLLRIFKVTKYWTSLRNLVSSLLNSLRSIISLLL
LLFLFIVIFALLGMQVFGGKFNFNPQQPKPRANFDTFVQALLTVFQILTGEDWNTVMYHG
IESFGGVGTLGVIVCIYYIVLFICGNYILLNVFLAIAVDNLADADSLTNAEKEEEQQEIE
GEDEEFDEGEEEGDEHGAEEPEGEEDMTSARPRRMSEVPAASTVKPIPKASSLFILSHTN
SFRVFCNMVVNHSYFTNAVLFCILVSSAMLAAEDPLQANSTRNMVLNYFDYFFTSVFTVE
ITLKVIVFGLVFHKGSFCRNAFNLLDILVVAVSLTSFVLRTDAMSVVKILRVLRVLRPLR
AINRAKGLKHVVQCVIVAVKTIGNIMLVTFMLQFMFAIIGVQLFKGTFFLCNDLSKMTEA
ECRGEYIHYEDGDPTKPVSKKRVWSNNDFNFDNVGDAMVSLFVVSTFEGWPQLLYVAIDS
NEEDKGPVHNSRQAVALFFIAFIIVIAFFMMNIFVGFVIVTFQNEGEREYENCELDKNQR
KCIEFALKAKPHRRYIPRNRLQYRVWWFVTSRAFEYVIFLIIVMNTVSLACKHYPSSRGF
EDFLDVFNLIFTGVFAFEAVLKIVALNPKNYISDRWNVFDLLVVVGSFIDITYGKLNPGG
TNLISINFFRLFRVMRLVKLLSRGEGIRTLLWTFMKSFQALPYVALLIVLLFFIYAVIGM
QFFGKVALDDSTSIHRNNNFHSFPAAILVLFRSATGEAWQDIMLSCSDREDVRCDPMSDD
YSKGGFNESRCGNNFAYPYFISFFMLCSFLVINLFVAVIMDNFDYLTRDWSILGPHHLEE
FVRLWSEYDPDAKGRIKHLDVVTLLRKISPPLGFGKLCPHRLACKRLVSMNMPLNSDGTV
CFNATLFALVRTNLKIYTEGNIDEANEQLRSAIKRIWKRTHKDLLDEVVPPAGKEDDVTV
GKFYATFLIQDYFRRFKKRKEMEAKGVLPAQTPQAMALQAGLRTLHEIGPELKRAISGNL
ETDFNFDEPEPQHRRPHSLFNNLVHRLSGAGAKSPTEHERLERGATLLPYEARSFSPTHS
LAGAEGSPVPSQMHRGAPINQSINLPPVNGSARRLPALPPYANHIHDETDDGPRYRDTGD
RAGYDPSQNRMVVANRKYADARVVGAARREIEEAYQLGEQEIDMAADSLAPLMQHVGMHD
IRDINENSRSALLRPAGESSRRQHDSHGGSQEDLLLVTTL
Download sequence
Identical sequences A8X1H0
CBG05858 6238.CBG05858 XP_002633153.1.8413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]