SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG05913 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG05913
Domain Number 1 Region: 1-22
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000524
Family LDL receptor-like module 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG05913   Protein: CBP26464   Gene: WBGene00028271
Sequence length 113
Comment CBP26464 WBGene00028271 status:Predicted UniProt:A8X1C7
Sequence
MCDGKIDCPDHSDEQHHICMKRNSVNKLQTQEINVGLKCPQPWFRCVDSSSCIAPHKKRT
FQRNIHDHTDTYITSRMKERGGVPLSIFTMTAEENHGFCHSFLIFRRSYHSSS
Download sequence
Identical sequences A8X1C7
6238.CBG05913 CBG05913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]