SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG06205 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG06205
Domain Number 1 Region: 6517-6873
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.05e-81
Family Protein kinases, catalytic subunit 0.00000000000752
Further Details:      
 
Domain Number 2 Region: 5311-5411,5501-5604
Classification Level Classification E-value
Superfamily Fibronectin type III 1.57e-42
Family Fibronectin type III 0.00038
Further Details:      
 
Domain Number 3 Region: 3958-4148
Classification Level Classification E-value
Superfamily Fibronectin type III 3.75e-42
Family Fibronectin type III 0.0009
Further Details:      
 
Domain Number 4 Region: 5610-5801
Classification Level Classification E-value
Superfamily Fibronectin type III 5.34e-42
Family Fibronectin type III 0.00059
Further Details:      
 
Domain Number 5 Region: 6000-6190
Classification Level Classification E-value
Superfamily Fibronectin type III 7.82e-42
Family Fibronectin type III 0.00036
Further Details:      
 
Domain Number 6 Region: 4542-4740
Classification Level Classification E-value
Superfamily Fibronectin type III 2.42e-41
Family Fibronectin type III 0.00052
Further Details:      
 
Domain Number 7 Region: 4834-5014
Classification Level Classification E-value
Superfamily Fibronectin type III 1.16e-40
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 8 Region: 2159-2354
Classification Level Classification E-value
Superfamily Fibronectin type III 5.58e-39
Family Fibronectin type III 0.00075
Further Details:      
 
Domain Number 9 Region: 4251-4445
Classification Level Classification E-value
Superfamily Fibronectin type III 1.11e-38
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 10 Region: 2455-2649
Classification Level Classification E-value
Superfamily Fibronectin type III 1.15e-38
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 11 Region: 2765-2955
Classification Level Classification E-value
Superfamily Fibronectin type III 3.54e-38
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 12 Region: 3663-3858
Classification Level Classification E-value
Superfamily Fibronectin type III 1.42e-37
Family Fibronectin type III 0.00067
Further Details:      
 
Domain Number 13 Region: 3057-3250
Classification Level Classification E-value
Superfamily Fibronectin type III 3.79e-37
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 14 Region: 1864-2052
Classification Level Classification E-value
Superfamily Fibronectin type III 2.42e-33
Family Fibronectin type III 0.00097
Further Details:      
 
Domain Number 15 Region: 5019-5119,5208-5301
Classification Level Classification E-value
Superfamily Fibronectin type III 5.52e-30
Family Fibronectin type III 0.0004
Further Details:      
 
Domain Number 16 Region: 6379-6487
Classification Level Classification E-value
Superfamily Fibronectin type III 5.48e-24
Family Fibronectin type III 0.00052
Further Details:      
 
Domain Number 17 Region: 6204-6303
Classification Level Classification E-value
Superfamily Immunoglobulin 1.18e-23
Family I set domains 0.011
Further Details:      
 
Domain Number 18 Region: 3438-3561
Classification Level Classification E-value
Superfamily Fibronectin type III 2.78e-23
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 19 Region: 5814-5909
Classification Level Classification E-value
Superfamily Immunoglobulin 2e-22
Family I set domains 0.0061
Further Details:      
 
Domain Number 20 Region: 7006-7101
Classification Level Classification E-value
Superfamily Immunoglobulin 8.46e-22
Family I set domains 0.013
Further Details:      
 
Domain Number 21 Region: 1243-1336
Classification Level Classification E-value
Superfamily Immunoglobulin 1.83e-21
Family I set domains 0.009
Further Details:      
 
Domain Number 22 Region: 7161-7253
Classification Level Classification E-value
Superfamily Immunoglobulin 2.83e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 23 Region: 3578-3671
Classification Level Classification E-value
Superfamily Immunoglobulin 5.62e-21
Family I set domains 0.023
Further Details:      
 
Domain Number 24 Region: 2071-2166
Classification Level Classification E-value
Superfamily Immunoglobulin 1.61e-20
Family I set domains 0.0093
Further Details:      
 
Domain Number 25 Region: 6305-6398
Classification Level Classification E-value
Superfamily Immunoglobulin 2.79e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 26 Region: 3265-3359
Classification Level Classification E-value
Superfamily Immunoglobulin 4.83e-20
Family I set domains 0.0052
Further Details:      
 
Domain Number 27 Region: 6883-6974
Classification Level Classification E-value
Superfamily Immunoglobulin 6.91e-20
Family I set domains 0.00000615
Further Details:      
 
Domain Number 28 Region: 3875-3966
Classification Level Classification E-value
Superfamily Immunoglobulin 5.29e-19
Family I set domains 0.0093
Further Details:      
 
Domain Number 29 Region: 2368-2463
Classification Level Classification E-value
Superfamily Immunoglobulin 1.25e-18
Family I set domains 0.0073
Further Details:      
 
Domain Number 30 Region: 4168-4259
Classification Level Classification E-value
Superfamily Immunoglobulin 1.48e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 31 Region: 3353-3467
Classification Level Classification E-value
Superfamily Fibronectin type III 1.63e-16
Family Fibronectin type III 0.00074
Further Details:      
 
Domain Number 32 Region: 2970-3064
Classification Level Classification E-value
Superfamily Immunoglobulin 1.98e-16
Family I set domains 0.014
Further Details:      
 
Domain Number 33 Region: 444-536
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000114
Family I set domains 0.051
Further Details:      
 
Domain Number 34 Region: 5422-5514
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000219
Family I set domains 0.0079
Further Details:      
 
Domain Number 35 Region: 2659-2772
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000627
Family I set domains 0.03
Further Details:      
 
Domain Number 36 Region: 5127-5223
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000065
Family I set domains 0.011
Further Details:      
 
Domain Number 37 Region: 172-270
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000217
Family I set domains 0.037
Further Details:      
 
Domain Number 38 Region: 7273-7359
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000807
Family I set domains 0.043
Further Details:      
 
Domain Number 39 Region: 1410-1490
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000104
Family I set domains 0.03
Further Details:      
 
Domain Number 40 Region: 4452-4550
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000546
Family I set domains 0.0000117
Further Details:      
 
Domain Number 41 Region: 1585-1669
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000689
Family I set domains 0.01
Further Details:      
 
Domain Number 42 Region: 7363-7439
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000272
Family I set domains 0.041
Further Details:      
 
Domain Number 43 Region: 9-64,117-160
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000908
Family I set domains 0.085
Further Details:      
 
Domain Number 44 Region: 1767-1872
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000303
Family I set domains 0.043
Further Details:      
 
Domain Number 45 Region: 1486-1572
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000317
Family I set domains 0.0099
Further Details:      
 
Domain Number 46 Region: 5907-6007
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000143
Family I set domains 0.029
Further Details:      
 
Domain Number 47 Region: 1676-1759
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000159
Family I set domains 0.026
Further Details:      
 
Domain Number 48 Region: 4755-4821
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000143
Family I set domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG06205   Protein: CBP35023   Gene: WBGene00028512
Sequence length 7455
Comment CBP35023 WBGene00028512 locus:Cbr-unc-22 status:Predicted UniProt:A8X0N6
Sequence
MVGAPRFTQKPSIQQTPTVGGGGGGDLLMECHLEADPQPTIAWQHSGNLLEPSGRVVQTL
TPLGGSMYKATLVIKKRCKQVIICCEVMGEEKRTKHKIEGISNDIKTREQSHQNTNHFHN
YRMLLVTVKPEPNAGDGGAYKCTAKNQLGESNANINLNFAGAGGDEAKSRGPSFVGKPRI
IPKDGGALIVMECKVKSASTPVAKWMKDGVPLSMGGLYHAIFSDLGDQTYLCQLEIRGPS
SSDAGQYRCNIRNDQGETNANLALNFEEPDPTERQERKRSTASPRPSSRGPGSRPSSPKK
SMKSREGTPKRTLKPREGSPSKKLRSRTSTPVNEEASQSESRRSSRTDKMEVDQVSGAAK
RKPDGLPPPGGDEKKLRAGSPSARKSPSRKSASPTPSRKASGAGGATGASGSATTTTTTS
NTTTTTSSTSSQQVHESSRDKYTRPPIVLEASRSQTGRIGGSVVLEVQWQCHSSTIIEWY
RDGKLVRNSSEYSQSFNGSIAKLQVNNLSEEKSGLYKCHAKCDYGDGQSSAMVKVEQSGE
SFLTGKKLTAENQWWFRELISASGTRCPQFYFRFDLNYLSHFSDVEEELMKHRKDMEDEY
QKEEEDRRVSQTLQAETKKRVARRSKSKSKSPAPQAKKTATSESMRSEASEGEQKRSSSV
RPDPDEMNYTPGSYLQNLLKRSASNEGSDHNNGASSSSASRRLPPRPPFEPSHSTASNPS
SSSNSPRRMFNLRSVSDRQGAARTNDQTPNPLNKNSSGQDLHKISQIHAFILSKMPEGEE
SQLDEIPSSGLTIPEERRRELLGQVGESDDEVSESISELPSFAGGKPRRKTDSQSSPPKQ
DEMFSRDTVLRKTTTSTRNESNTVEVCLFNVCFSFLCLFVPFQEKTKLRKTVKKADGELD
FKAMVKLKKVKKEEGGTADKPGFPLDRTDSTSSVLSQDSRSRRGSTSLFSKDGHPEQAGN
PFAQLKKVKTGAGGLEKSDSTASMKKLELKKGKVEENSDGAFKVQLKKVVKKEVKESSIS
VKEKNGTESGIKTEFKMEKRERTTLQKYEKTDSNGSKKEDKPKKVSIAPVATSTSSDEPT
TPRVRDKTTLEKEFRMHHEKVEEKSKSEELKSKVGGRQVGQKRNGAAPKPEEPKNLLSQI
QLKKVTKKAQEETNELEGIKLKKVPGVPKHVADDESQSESESRRGSVFGEFRRGSRAPRD
SADNSRRDSIRRSSIDMRRESVQEILEKTSTPLVPSGASGSAPKIVEVPENVTVVENETA
ILTCKVSGSPAPTFKWFKGSREVISGGRFKHITDGKEQTVALALLKCRSQDEGPYTLTIE
NAHGTDSADVKLLVTSDNGLDFRAMLKHRYSYFFRLWILESQAGFQKDGEGGGGGGGDKK
PMTEAERRQSLFPGKKVEKWDVPLPDKTVQQQVDKICEWKCTYSRPNAKIRWYKDRKEIF
SGGLKYKIVIEKNVCTLIINNPEVDDTGKYTCEANGVPTHAQLTVLEPPMKYSFLNPLPN
TQEIYRTKQAVLTCKVNTPRAPLVWWRGSKQIQEEDPRFIIEKDAVGRCTLTIKEVEEDD
QAEWTARITQDVFSKVQVYVEEPRHTFVVPMKSQKVNESELATLETDVNDKDAEVVWWHD
GKRIDIDGVKFKVESANRKRRLIINGARIEDHGEYKCTTKDDRTMAQLIVDAKNKFLVAL
KDTEVIEKDDVTLMCQTKDTKTPGIWFRNGKQISSMPGGKFETQSRNGTHTLKIGKIEMN
EADVYEIDQAGLRGSCNVTVLEAEKRPIINWKPKKIEAKAGEPCVVKVPFQIKGTRRGDP
KAQILKNGKPIDEEMRKLVEVVIKDDVAEIVFKNPQLADTGKWALELGNSAGTALAPFEL
FVKDKPKPPKGPLETKNVTAEGLDLVWGTPDPDEGAPVKAYIIEMQEGRSGNWVKVGETK
GTDFKVKDLKEHGEYKFRVKAQNECGLSDPLTGESVLAKNPYGVPGKPKNMEAIDIDKDH
CTLAWEAPEEDGGAPITGYIIERREKSEKDWHQVGQTKPDCCELTDTKVVEDKEYLYRVK
AVNKAGPGDPCDHGKPIKIKAKKAAPEFTGGGIKDLRLKVGETIKYEVPISGEPLPDCTW
IVNGKPLKAVGRVKMSSERGKHVMKIENAVRGDSGQYTITLKNSSGTCDSTATVTVVGRP
TPPKGPLDITDVCADGASLSWNPPEDDGGDPLTGYIVEAQDMDNKGKYIEVGRVDPNTTN
LKVSGLRNKGNYKFRVKAVNNEGESEPLSADQYTQIKDPWDEPGKPGRPEITDFDADRID
IAWEPPHKDGGAPIEEYIVEVRDPDTKEWKEVKRVPDTNASITGLKEGKEYQFRVKAVNK
AGPGQPSEPSEKQLAKPKFIPAWLKHDNLKSITVKAGATVRWEVKIGGEPIPEVKWFKGD
QHLENGIQLTIDTRKNEHTILCIPSAMRSDVGEYRLTVKNSHGADEEKANLIVLDRPSKP
NGPLEVSDVFEDNLNLSWKPPDDDGGEPIEYYEVEKLDTATGRWVPCAKVKDTKAHIDGL
KKGQTYQFRVKAVNKEGASDALSTDKDTKAKNPYDEPGKTGTPDVVDWDADRVSLEWEPP
KSDGGAPITQYIIEKKGKHGRDWQECGKVSGDQTNAEILGLKEGEEYQFRVKAINKAGPG
EASDPSRKVVAKPRNLKPWIDREAMKTITIKVGNDVEFDVPVRGEPPPKKEWLFLEKPVD
DQKIRVSFLISNFLNQTLNSKSNEDYKTRFVLRGATRKHAGLYTLTATNASGSDKHSVEV
IVLGKPSSPLGPLEVTNVYEDHCDLEWQVPEDDGGAPIDHYEIEKMDMATGRWVPCGRSE
TTKTTVPNLQPGHEYKFRVRAVNKEGESDPLTTNTAILAKNPYEVPGKVDKPELVDWDKD
HVDLAWKTPDDGGAPIEAFVIEKKDKNGRWEEALVVPGDQNAATVPNLKEGEEYQFRISA
RNKAGTGDPSDPSDRVIAKPRNLAPRIHREDLSDTTVKVGAALKFIVHIDGEPAPDVTWT
FNGKGIGESKAQIENEPYISRFALPKALRKQSGKYTITATNVNGTDSVTIDIKVKSKPTK
PKGPIEVTDVFEDRATLDWKPPEDDGGEPIEFYEIEKMNTKDGIWVPCGRSGDTHFTVDT
LNKGDHYKFRVKAVNSEGASEPLETDTDILAKNPFDRPDRPGRPEPTDWDSDHVDLKWDP
PLSDGGAPIEEYQIEKRTKYGRWEPAITVPGGQTKATVPDLTPNEEYEFRVIAVNKGGPS
DPSDASKAVIAKPRNLKPHIDRDALKNLTIKAGQSISFDVPVSGEPAPTVTWHWPDNREI
RKGGRVKLDNPDYQSKLVVKQMERGDSGTFTIKAVNVNGEDEATVKINVIDKPTPPNGPL
DVLDVHGDHVTLDWRAPDDDGGIPLENYVIEKYDTANGRWVPAAKVPGDQTTAVVDGLIP
GHEYKVTPQSILYILHIVMFQFRVAAVNAEGESEPLETFGTTLAKDPFDKPGKTSAPDVT
DWDKDHVDLEWKPPANDGGAPIEEYVVEMKDEFSPFWNEVAHVPASQTNATVGNLKEGSK
YEFRIRAKNKAGLGDPSDSASAVAKARNVPPVIDRNSIQEIKVKAGQDFSLNIPVSGEPT
PVITWTFEGTPVESDDRMKLANEDGRTKFHVKRALRSDTGTYIIKAENENGTDTAEVKVT
VLDHPSSPRGPLDITNIVKDGCDLAWKEPEDDGGAEVSHYVIEKQDAATGRWTACGESKD
TNFHVDDLVQGHEYKFRVKAVNRHGDSDPLEAREAIIAKDPFDRADKPGTPEIVDWDKDH
ADLKWTPPADDGGAPIEGYLVEMRTPSGDWVPAVKVGAGELTATVDGLKPGQTYQFRVKA
LNKAGESTPSDPSRTMVAKPRHLAPKINRDMFVAQRIKAGQTLNFDVNVEGEPAPKIEWF
LNGTPLPSGGKTHIDNNTDNNTKLTTKGTARADSGKYKIVATNESGKDEHEVDVNILDIP
GAPEGPLRHKDITKESVVLKWDEPLDDGGSPITNYVVEKQEDGGRWVPCGETSDTSLKVN
KLSEGHEYKFRVKAVNRQGTSAPLTSDHAIVAKNPFDEPDAPTDVTPVDWDKDHVDLEWK
PPANDGGAPIDAYIVEKKDKFGDWVECARVDGKTTKATADNLTPGETYQFRVKAVNKAGP
GKPSDPTGNVVAKPRRMAPKLNLAGLLDLRIKAGTPIKLDITFEGEPAPVATWKANDKTV
EAGARADVTNTPTSSALNVFSAARGDTGVYKIIVENEHGKDTAQCNVTVLDVPGTPEGPL
KIDEVHKEGCTLNWKPPTDNGGTDILHYIVEKMDTTRGTWQEVGTFPDCTAKVNKLVPGK
EYSFRVKAVNLQGESKPLEAEEPIIAKNQFDVPDPVDKPEVTDWDKDRIDIKWNPTANNG
GAPVTGYIVEKKEKGSALWTEAGKAAGTTFSADNLKQGVEYEFRVIAVNAAGPSDPSEPT
DPQITKARYLKPKILTANRKIKIKAGFTHNLEVDFVGAPDPTATWTVGDGAALAPELIVD
AKTNTTSIFFPSAKRADSGNYKLKVKNELGEDEGIFEVVVQDKPSPPEGPLEVSDVTKDS
CVLNWKPPKDDGGAEISNYIVEKRDTRTNTWVPVSAFVTGTSITVPKLTEGHEYEFRVMA
ENAFGRSDSLNTDEPVLAKDPFGTPGKPGKPEIVDTDNDHIDIKWDPPRDNGGSPIDHYD
VERKDAKTGRWIKVNTSPVQGNAFSDTRVQKGHTYEYRVVAVNKAGPGAPSDPSASATAK
PMHEAPKFDLDLDGKEFRVKAGEPLVITIPYTASPQPDISWTKEGGKPLAGVETTDSQTK
LVIPSTRRTDSGPVKIKAVNLMEKLKPISRSLRHTCTLNWDAPKDDGGAEIAGYKIEYQE
IGSQIWDKVPGLISGTSYTVRGLEHGQQYRFRIRAENAVGLSDYCQGVPVVIKDPFDPPG
APSTPEITGYDTNQVSLSWNPPRDDGGSPIIGYVVERFEKRGGGDWAPVKMPMVKGTECI
VPGLHENETYQFRVRAVNAAGQGEPSNGSEPVTCRPYVEKPGAPDAPRVGKITKNSAELT
WNRPLRDGGAPIDGYIIEKKKLGDNDWTRCNDKPVRDTAFEVKNLGEKEEYEFRVIAVNS
AGEGEPSKPSDLVLIEEQPGRPIFDITNLKDITVRAGETIQIRIPYAGGNPKPIIDLFNG
NSPIFENERTVVDVNPGEIVITTTGSKRSDAGPYKISATNKYGKDTCKLNVFVLDAPGKP
TGPIRATYIQAEAMSLSCRPPKELRSQITCSKRELREGDWVTVGHPVGTTLRVRNLDANT
PYEFRVRAENQYGVGEPLETDDAIVAKNPFDTPGAPGQPEAVETSEEAITLQWTRPTSDG
GAPIQGYVIEKREAGTTEWTKAAFGNILDTKHRVTGLTPKKTYEFRVAAYNAAGQGEYSA
NSVPITADNAPTRPKINMGMLTRDVLAYAGDRAKILVPFAASPAPKVTFSKGEKKISATD
PRIKVEYSDFLATLTIEKSELTDGGLYFVELENSQGSDSASIRLKVVDKPAPPQHIRVED
IAPDCCTLYWMPPSSDGGSPITNYIVEKLDLRHSDGKWEKVSSFVRNLNYTVGGLIKDNR
YRFRIRAETQYGVSEPCELSEVVVTKYQFDVPNQPEAPTVRDKDSTWAELEWDPPKDGGS
KVIGYQVQYRDTSSGRWINAKSDLAEQCHTRVTGLRQNGEFEFRIIAKNAAGFSKPSPPS
ERCQLKSRYGPPGPPIQVGAKSIGRNHCTITWMPPLEDGGSKITGYNVEMREYGSTLWTV
VSDYNVREPEFTVDKLKEFNDYEFRVVAINAAGKGIPSLPSGPIKIQESGGTRPQIVVKP
EDTAQPYNRRAVFVCEAVGRPEPTARWLRNGRELPESSRYRFESSDGVYKFTIKEVWDID
AGEYTVEVFNSYGSDTATAKLIVQAPPVIEKDVPNTILPSGDLVRLKIYFSGTAPFRHSL
VLNKEEIDMDHPTIRTVEFDDHILITIPALSVREAGRYEYTVSNDSGEATTGFWLNVTGL
PEAPQGPLHISNIGPSTATLSWRPPVTDGGSKITSYVVEKRDLSKDEWVTVTSNVKDMNY
IVTGLFENHEYEFRVSAQNENGIGAPLVSEHPIVARLPFDPPTSPINLEIIQVGGDYVTL
SWQRPSSDGGGRLRGYIIEKQEEGHDEWFRCNQNPSPQNTYNVPNLIDGRKYRYRVFAAN
DAGLSDPTELDQTLFKASGAGEGPKIVSPLSDLNEEVGRSVTFECTVSGNPRPEYRWFKG
CKELVDTSKYTLINKGDKQVLIINDLTSDDADEYTCRATNSSGTRSTRASLRIKTKPRVF
IPPKYHGGYEAQKGETVELKIPYKAFPQGEARWTKDGEKIENNSKYSITTDDKFATLRIS
DASREDFGEYRVVVENSVGSDSGIVNVTVADVPEPPRFPIIENILDEAVILSWKPPALDG
GSLVTNYTIEKREAMGGSWAPCAKSRYTYTTVEGLRAGKQYEFRITAENKHGPSKPCEPT
APVTIPGDERKRRRGYDVDEQGKIVRGKGAISSNYDNYVFDIWKQYYPQPVEIKHDHVLD
HYDIHEELGTGAFGVVHRVTERATGNNFAAKFVMTPHEADKETVRKEIQTMSVLRHPTLV
NLHDAFEDDNEMVMIYEFMSGGELFEKVADEHNRMSEDEAVEYMRQVCKALCHMHENNYV
HLDLKPENIMFTTKRSNELKLIDFGLTAHLDPKQSVKVTTGTAEFAAPEVAEGKPVGYYT
DMWSVGVLSYILLSGLSPFGGENDDDTLRNVKVIVFGLTSSFLTISNFQSCDWNMDDSAF
SSISEDGKDFIRKLLLADPNSRMTIHQALEHPWLSPGSVPGRDSQIPSSRYTKIRDSIKS
KYDAWPEPLPPLGRISNYSSLRKHRPQEYSIRDAFWDRSEAQPRFIVKPYGTEVAEGQSA
NFYCRVIASSPPVVTWHKDDRELKQSVKYMKRYNGNDYGLTINRVKGDDKGEYTVRAKNS
YGAKEEIVFLNVTRQSAPLKFEPLEPMKRAPSPPKVEEFKERRSAPKFTFHLRNRLIQKN
HQCKLTCSLQGNPNPTIEWMKNGHPVDEDRVQVSFRSGVCSLEIFNARVDDAGTYTVTAT
NDLGMDVSECVLTVQTKGGEPIPRVSSFRPRRAYDTLSTGTDVERSHSYADMRRRSLIRD
VSPDVRSAADDLKTKITNELPSFTLQLSDAETDVGESVEFSAQVTGQPEPLIEWLHNGER
ISDSDSRYRSSFVGGKATLRVSDIKKSDEGQYLCRASNSAGQEQTRATLTVKGEQPLVNG
HVETAENQLRVAKHLAGEVVKTGEAVTFEARIEGTPDEILWMRNGQELTDGEKTSISQNG
DTLLLTVNSAEASDAGHYQLEVRSKGTNIVSVASLVVVGEKADPPVTRLPSSVSAPLGGS
TSFSIDFENVEGLTVQWFRGSEKIEKNERVKSVKSGNTFKLDIKNVEQDDDGIYVAKVVR
EKKAIAKYAAALLLI
Download sequence
Identical sequences A8X0N6
6238.CBG06205 CBG06205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]