SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG06666 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CBG06666
Domain Number - Region: 336-370
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0827
Family Fibronectin type III 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG06666   Protein: CBP27229   Gene: WBGene00028910
Sequence length 975
Comment CBP27229 WBGene00028910 status:Predicted UniProt:A8X2T3
Sequence
MITKSNDIIFKNPIMFIVFVFLIMPSIAQPHLKTKCSLECYAVCMHSGTPSASTCNCPVS
RDPSNCTKFDADFQTGNFCNIATDIYNPDIFSARISTIIPKTKSEYVDAHMIRVSIEPQP
SAFAYAFEYSTISTEPDNWIFAGASAKPEAIFSILDPCRDYQFRVIIVVRSSNPSEVLDI
IRPQPIPVQLPPFILTQQQISIEMPRGSSQNSSEDLKLYVKWLLPSGYIDGDIYSYESPA
LYPIQCSTPEGEIPTPRIEIVRGGGRLAVWLPPSVLEARCRMWVEVKMLPRCVRLEPFNI
QKNIEIDCSKNPNLEICNKESNPVCFESVNIGGEHGKARISWEAPEKNPLYYHVRYGPAE
SKGIAPFVTWQLAAKREVRVDGLLSSFSLDIPEDEDFGVQVCAILSKKRKRPKFGVIQVI
PFQCSSCKTTQTTGCADCGLILGSTVLEKGWMNKTPPRKPDTTTQTTLSPKPQTSTVYRM
ETDLSVSGNGIRNDPHVKVKSGTRHSTDSPINLEKAEEINKKTVETQEEETTTITTTPKS
QSSISPDKKTPAPKPILKVPSLLFPPKLFGATTSESQPTTSPNTSEATIPINVSHKPTTH
KPTPPETQSSSRIMSEELEKSVENLEKAIEETMKNGSGKLNNQTIEAVEKIDRELEIRSE
EVEKQLQDSLANLVANNSEIRHHEKSKKCLTSEGVVCEFGCEDRKKCFCPPSTHARLMNG
VCVSRATMLHTICLPRREINATWDSESGNIMVRRSDALYHIQHAENVDKLFVEFGKASVL
ADKENNETIIEFNDPQRSKIVVLIQTVLKSSVFSTEPFIFHVNESIDMNSTYGMRLCVFN
SSQIRSPHNYNWDDRSRFEKHEQIAEVIQLSPVRFTNKLPLLFPSTDTYWSTVMTIAKIS
ILVILALAIFILVYLNCTKFRTLYDRKRTHYFRPFYIDPSIHLSNTAPSSRGSGGGLKRD
PSRGYYDVRNSHLIM
Download sequence
Identical sequences A8X2T3
6238.CBG06666 CBG06666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]