SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG06905 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG06905
Domain Number 1 Region: 9-44
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000144
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG06905   Protein: CBP01758   Gene: WBGene00029096
Sequence length 1283
Comment CBP01758 WBGene00029096 status:Predicted UniProt:A8X3B9
Sequence
MTVSSTSAAECPPNTFTCADGSCIPSDWKGDGEKDCEDGSDEVEGVTGTTVEGKFDEVVT
SGTTTSGVTSSDEECDWGMQQRIDNCSEPIVMFLHQIERLNLKNMSFLTSSEVQSQIESG
CNLMTNYQECVGNEKGCMPDEGVHSWREIEMFMCQLVLPSVKEHSACFKASADSRCDASK
TSSSSSLCGLVTSIQTATSCLETIRPEACSSDAIEMLAPIREETEHIVSAIRCVLPEQSS
STTLIVDETTESTSASAEDDGDILTTATDSESTTTTTNQEMENRPALTINMADAVNSLYY
IYDICSANYSSDPFAAVAERICAKQDEIAKWSDCYQKTLEKEKCAIRNATSKCEALISYN
NNLDCAIVTMNDECEVDAQNLVVELQEEVNDLIIAGKCFDEKKEEEEKAPSPPKEGEFHL
QTTLPKCTEEQENGALGCLVELVEINKKLTAFSNLNFLLEIASPNSSVVEGICSLFARYE
QCLSVTVFKDSQRCSFASPLNSLARIGLAPICSLDSRPMLAKHRSCFEKLATEADEETNC
QSALSSLSNTVQMMLNGVHGEALLCKSFYTIRDTFSCGEKAVKNKCEEDALTDLMNLKTK
MTSLGLEEGCPRDPPANLDEIIARPVARPTPVTMPPRAPTARPMPLPAVPPPTQPSSPSK
CAVEEQKKFEECVKPLTSFQPHPLSVIAMPRDIDQACEAFHTFKACSAESNCHPLWARGM
SAMFEYACNEANEQFKKVRKCIRETSMIEEVRSCVSDFSRGAPTAACMSSNRLHSCAIPQ
IQAKCGQEAADWVSNYIIRFANAIDVRCKVGRQLPVGRVVGIGCSAEEEVIIEHCAAPLN
DIGSRVEELFAGGMQSLIKNINSLAPVFAGACNLTDEFKTCAHFLLEGRTSCVVSSCMIE
AGRNICQLSDPAKAIDDNLSCLFGQAQEPKFAQCIRSTISTLKQFNLSTLRSVLPKFIDC
TKDIVIDKCGESPITIMKAMSTPDICPIRPNHAPIVVNAPTRVTPNLGTVLSSSTASTMA
SEETETTEVTEAATEAPTTPETGCGESALVDYYQCETHLDQFAFRPISIIGDASKWDQFC
QMANQTYIPCVEGLKCKSEPAATAQIGLIDSICNREITLRDQKQHAMCLSEYTKSDAGLA
CISDFGKIDQLDKSSPAQMCDGINHVMRCSTTEIEKRCGFDAVLHVFSVHMHWANLFNAS
CILESPEPSKEITSIDVNEVEPSRDQKPVVVTKDETTPMAVTTAMNNDVTEPEETTTTTT
APVQSTVSFAVVLATVLPFFALL
Download sequence
Identical sequences A8X3B9
CBG06905 XP_002642486.1.8413 6238.CBG06905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]