SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG07008 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG07008
Domain Number 1 Region: 35-175
Classification Level Classification E-value
Superfamily EF-hand 5e-18
Family Calmodulin-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG07008   Protein: CBP31143   Gene: WBGene00029183
Sequence length 249
Comment CBP31143 WBGene00029183 status:Predicted UniProt:A8X3X6
Sequence
MANPILCLLLVSLALSAPVPLPLEEDFNVFHTKQENHEQRFLRVDQNKDKVVTFDEFLHM
ELAYVDAKKEEFDTLDKNHDGKVSLAEYEEHFHEASSKSEKSRTAYFAKVFEDFDEDFNM
ALSRDELERVLAERFLVKPRENFPKLFFKFDVDKSGGLDLTEYMKFDAEFPFDQTDPVGG
GPSKANSHHNQMHTEVPQDADAAAIAAVLAQASPTLNKAPAGVAPQHNAPGLHPVAPGSV
QPAVPIKKI
Download sequence
Identical sequences A8X3X6
CBG07008 6238.CBG07008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]