SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG07568 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG07568
Domain Number 1 Region: 773-846,891-962
Classification Level Classification E-value
Superfamily Immunoglobulin 3.71e-19
Family I set domains 0.028
Further Details:      
 
Domain Number 2 Region: 125-232
Classification Level Classification E-value
Superfamily Immunoglobulin 2.58e-16
Family C1 set domains (antibody constant domain-like) 0.037
Further Details:      
 
Domain Number 3 Region: 954-1061
Classification Level Classification E-value
Superfamily Fibronectin type III 7.53e-16
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 4 Region: 231-331
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000027
Family I set domains 0.012
Further Details:      
 
Domain Number 5 Region: 577-686
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000165
Family C1 set domains (antibody constant domain-like) 0.052
Further Details:      
 
Domain Number 6 Region: 20-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000101
Family V set domains (antibody variable domain-like) 0.037
Further Details:      
 
Domain Number 7 Region: 681-774
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000859
Family I set domains 0.029
Further Details:      
 
Domain Number 8 Region: 330-419
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000188
Family I set domains 0.046
Further Details:      
 
Domain Number 9 Region: 445-559
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000191
Family V set domains (antibody variable domain-like) 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG07568   Protein: CBP27630   Gene: WBGene00029565
Sequence length 1270
Comment CBP27630 WBGene00029565 locus:Cbr-syg-2 status:Predicted UniProt:A8X4J5
Sequence
MIPLATVIWLLGIIHQTRQLFLESPSNLSTIAGESITFRCAAEKSPEPIVYSQWKSNTGS
LLGYHQEGVLPGHQGRFSYVKQNAEELHLKITHVNLDDDGEYECQMLHPEEGPIRAKAFL
NILVPPQLVYFSNYQPNSVIAVKENTPLNITCVVPNVKPDPQVSWYMDGKVMSRDVKQAS
MPHLNKTFTVYTSLVIQPGRSDHGKIVTCEVVQKETETRITTNTTLDVLFPPSEPIVEIL
GNPSVLRAGDNVTVACAVTGGNPPPDVFWYHENKRLQSHSTLDTRTKEIRNVYSFIATQN
DNMAEYECRANNSHSGNAKRKALKFEVNYPPASVELFGESNIRYGSSAMIQCKSLSSNPA
SQITWVINGRTVPTPTQREFFMENGIVSSSNISVHSNELSQDAHQINVECIATNPEGSSA
KQHLIKIIGKTFFLHFYCNVAIPAPPKAPRITGLEDRKFFEGDIVNVTCEAQGGNPLAEL
SWYRGSEKFDTENIFEAFGKRKKEDEMVNGAHNEVAGFSSFSTLALRVDRTMNTQRLKCE
ATNAALDEPLIESQYLSVYCKFQINQYFNRASPFPDPPRRVLIRPAESSDQRLLINKPAR
LVCGTLSSNPAAQITWQFSRANDGKVHPGDVSLNETTRDNGYNVENVLSFVPTEEYDGTV
VHCIANHPEWKHSVNTSFPLNVMYPPKMLVNDPVTVIMSEGDSFKENLTVRGNPAVSLWQ
WRKNGVPFDHTIGRVFARGAVLSGKQLLSTDAGVYTLTATNSVGSTNITIKLAVEYSARI
TSISTPAIAATGDTILLECEAEGEPSKSNMINWYKNGEPLPTQYRGNKKAILRLNATEQQ
SGEYICRADNGIGVPAEGKTFLLVNSAPRVLPVARYSKTAGILGGVAKARCKVYAVPTVE
FVWEKDEQLIKKNSSKYSIVNTQIDYSTYESTLWIKNIVPDDYTKTVKCIARNSFGTDYL
SIPIIPPTNPEEPFNLTMTNSTLNTISVAWEPRFDGGSDQIFEIKYKKQNDDLIHLVNTS
HTNLRLSGLAIANTYYFQIRAINARGFASGWTSPVIFATLNEDGVNIAMVQNREMKYIKY
FPVLLIAICCILIAILVACCLLCSRNKKRKLREKTEMARTAINGGDVRQVQMYGTMMGHD
GMTRHDIDDRPDMSEDEHSVRTMIEVSPNGYMQPIEPMLYESTGLLEYDYQSGRSYMGSS
QGTTGRNITYANVPYPEPPQPSYHHHSNWNSLQRQSNNNTSPQHHLSTFINPMGVRAGPI
NYAQLDGDLV
Download sequence
Identical sequences A8X4J5
CBG07568 6238.CBG07568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]