SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG07635 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG07635
Domain Number 1 Region: 22-57
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000353
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 2 Region: 134-174
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000314
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 3 Region: 66-107
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000851
Family LDL receptor-like module 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG07635   Protein: CBP34956   Gene: WBGene00029616
Sequence length 339
Comment CBP34956 WBGene00029616 status:Predicted UniProt:A8X4E4
Sequence
MNFFLALISLSLFHSIKSASDVCADGQFACNDGRCITNDWVCDGARDCSDGSDEHHEACD
KHMNKNSSCFGNQPECKKHGLARCIPHEWLCDGHPDCDAGEDEYNCTSIDWFRQPESLMR
KYQSLLADKSTTTQYFTYCSSDEFRCESSGNCLKPSQLCDGKPDCGKGEDEKNCTKKSEN
TTVSSGRNATALMSTTTKLPVTTSRLENITLNGLLLAKPTTLTTATSSKLSTTTTTSATT
TTSTTTTTPPKTTTIEPITETTKPLIIHIEPTLPSSSYILPTTRSSVPTTSTTITTQKVV
ARTFATQLHTTQPPKIAVKLLNDSWSNSTAEKRSKKKHR
Download sequence
Identical sequences A8X4E4
6238.CBG07635 CBG07635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]