SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG08103 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG08103
Domain Number 1 Region: 677-772
Classification Level Classification E-value
Superfamily Immunoglobulin 8.69e-17
Family I set domains 0.039
Further Details:      
 
Domain Number 2 Region: 755-882
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000338
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 3 Region: 143-263
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000247
Family I set domains 0.024
Further Details:      
 
Domain Number 4 Region: 452-589
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000131
Family I set domains 0.056
Further Details:      
 
Domain Number 5 Region: 569-645
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000416
Family I set domains 0.016
Further Details:      
 
Domain Number 6 Region: 260-352
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000112
Family I set domains 0.014
Further Details:      
 
Domain Number 7 Region: 341-423
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000118
Family I set domains 0.025
Further Details:      
 
Domain Number 8 Region: 30-138
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000051
Family V set domains (antibody variable domain-like) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG08103   Protein: CBP34647   Gene: WBGene00029965
Sequence length 1145
Comment CBP34647 WBGene00029965 locus:Cbr-igcm-1 status:Predicted UniProt:A8X5T7
Sequence
MTEKRLLIFLLLALFDKAVSSDVFLVEPSTDPYYVKEGSEGVLIPCAVKPEYLDEKKYEI
NWARYNNGQLRMITKNDKLLIKKHSKFVLENDAATGNYSLRISEVEKNSVEGTYHCNVIA
TDDSDMQYSALATIVVLAHISVPPGDPIISTTPVESVIEGDFLTAKCVSVGGSPQPTFTW
TLPNETIASSTLFTTQHRDGATESLLQYGFSCHVLTIILSLFSFRVFSRDDGKSVQCDVT
NRAMLAGETKQVRSSQLNVLYKPIVFVTPTENLTHLSVEEGELVNLTCNAAANPPAHSYE
WKHISSGDRYQGKVWPIYVNRSMDGDFECRGTNELGEGSSLLKLVVQHTPKITVPVSTPF
VSPNEMEDVDVQCEISAVPDVIDIKWIGPNGFKQNGSRLTLNGISKSQSGNYTCMATNFL
TVYGQSGSQQRMGTGTTLVDVKRKPGQAQIVSSRQSVDVGETIKLICQAEDAGNPSSSYT
VCLVLTIAIQMRKFQWASPSSGGIFGLEGHNDKSFEVRNAQLSDNGVYSCKAYNDLGEGK
PAIIMITVIEHARISSPLATERIFSAGEQGKMLVCEAQGYPTPVISWLKDGVPIKQNYYK
SAATTESKCLPEDFCTQTATSTLTFSRPLKWSDKGNFTCVADNGSDRDDKDSNSWSIIRI
LHKPVILNRRFPEKSLAAADIGSQAILRCKVSARPEPEFHWMFKDSEIFENDRLSFHTVS
TFQKPDDYEQMLQIESVQESDYGEYVCQATNGNGGDDVVIELRRTSPPALPLDLQKLSAT
SNSVLIGWVPQFDGGFNQSYVLESRKIDPYSGEIDDNAPVSRLDIHAVQQEYEIDGALVS
KTVFNFTGLTPLSTYNLRVQAVSEKGQSEFTPVLIASTEDVVEDPNMMSPIVLFWILGNR
KLTSRLPKLPSDACTLLYVFVDGIWRTSICHTSSNPILNIVSGREYKARFCTTANGLKCS
PVSKTICKHITSNNSRNLLFKQVAPDQLGKLTFSFHSCFSFSSVLLSLCFSSCAAKQDQV
PKLQSYRNFSVHLAFEKKPVYRPIVLTSLPGDELKKPANYEETKNSTYMITENGTNSLNH
HLSLENSQKPGKPGSNMEYDVSNDCYLQENTDVLKNSSISCFGTSETLDNSDSNEDRRIV
REIIV
Download sequence
Identical sequences A8X5T7
6238.CBG08103 CBG08103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]