SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG08127 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG08127
Domain Number 1 Region: 657-738,834-879
Classification Level Classification E-value
Superfamily Fibronectin type III 6.09e-19
Family Fibronectin type III 0.0056
Further Details:      
 
Domain Number 2 Region: 224-324
Classification Level Classification E-value
Superfamily Immunoglobulin 1.7e-16
Family I set domains 0.0091
Further Details:      
 
Domain Number 3 Region: 472-588
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000237
Family I set domains 0.017
Further Details:      
 
Domain Number 4 Region: 329-364,450-500
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000231
Family I set domains 0.066
Further Details:      
 
Domain Number 5 Region: 35-102
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000132
Family C1 set domains (antibody constant domain-like) 0.085
Further Details:      
 
Weak hits

Sequence:  CBG08127
Domain Number - Region: 176-228
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0246
Family I set domains 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG08127   Protein: CBP27926   Gene: WBGene00029985
Sequence length 965
Comment CBP27926 WBGene00029985 locus:Cbr-ncam-1 status:Predicted UniProt:A8X5V7
Sequence
MTTTLWLSLLFIGLPTVSGWTLTVSPSEERLQNRRSGDNFLAVCKVKDFDGAASDVKIEW
FRDGKLIPRFGSTMTIERTYSNQLMINRPKISDGGKYTCQTEIHGEKQEISADISFVGKW
FDVQIPQNSSMYKTSNTLKRELVLKSSAKWWELINSRCFGSLMALPWTKVSVSTSQRGYE
FSENNQILYIPHFTAKKDDGVYNCNAAQYSSFETLSVNVTGYARPTITVFDVPNGNRGIE
GHTIELKCGAVGKPKPAYEWFFEECIFQDDEVPIARSDKHNVDEGLLIIESLNSEDAGTY
KCIANNTVGTNERSFELSVFLKPKVDLKHDHVVKEGEDVELVCSYNGGGHVTAKFTSGSR
EFTVKKDHSEEVHSEEIPKEETDSQETGTKEPSTSEETATTDEEIEIKSADSSDNDENEE
TTASNNDEDDHADEQEESKRWKRFADDVNSERITLQAEENKLILHIKNIALEDAADYTCA
VTNDAGTTNKVTQVGIIHPPTLRHYTGPHVRSFNGNTVSIYCDVSAVPSPKWHWYKDGKE
VEANGASVQIDTQASSTKLTLETFYGSDNFGVYICKADNGVGKLEKQIEVIKVVAPPTPE
GMDCKKLIYPNYGKCAVYSDLYEKEESKPQTIDFLVAKFEEMESDYNWNHARAVSVPFEE
DITIPDLAPNTQYVVKARAVNEAGHSDYTEEINFETTDPWVPQSPQQVTMKCSDYCTVSW
DTPNSHGSPLLKYRITIQEMRLKNANESKEEEEHHEKTESTSSSQNSGEDEDSVDNVEST
TGDNESEESTENTENASIEITEHHETSLTNQHSAEILPTDPTTSVERDSLEMVAYGSLMV
LEVDASENQLQLTNIKSHSYYKVAVSAENAIGQGEPAEFEHQTNESPTKYDEGFDTTHLT
IAIAIGVLVLLLLIDLGCYITNRCGLISCICLNLCGKSSGGKQSDLESGRSGPESNRLLD
SSGAR
Download sequence
Identical sequences A8X5V7
CBG08127 6238.CBG08127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]