SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG08159 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG08159
Domain Number 1 Region: 10-43,102-165
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000109
Family Voltage-gated potassium channels 0.007
Further Details:      
 
Domain Number 2 Region: 159-239
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000249
Family Voltage-gated potassium channels 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG08159   Protein: CBP29497   Gene: WBGene00030011
Sequence length 293
Comment CBP29497 WBGene00030011 status:Predicted UniProt:A8X5Y3
Sequence
MRASELSPKFQYAFRRCLFYTFVLVAWLFMGMILFPALCTPTVKQDDNEAGVFRLDAKRS
DLLNVLWAETITNGEDDWSALADQKLELYEKALLQHYGIDLDKSDKSFASGLQKSFAIST
TIGPLDVDDFTTVGKFIAVIYALIGTPLFLTVIGQLGKMVTSLWQGTTLWVVTIVYIFIS
AMIYDIVEGGSDDVPFIEAIFSIFLQFTTVGEVDNEFHGVLPYGIVVLGLALITALYQEM
QQNIEHFIHPFEYSFNRLCGTVERWVGERDEAKKSIAETRIEEENEDELSDYE
Download sequence
Identical sequences A8X5Y3
6238.CBG08159 CBG08159

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]