SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG08169 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  CBG08169
Domain Number - Region: 245-302
Classification Level Classification E-value
Superfamily RecG, N-terminal domain 0.00222
Family RecG, N-terminal domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG08169   Protein: CBP27597   Gene: WBGene00030021
Sequence length 303
Comment CBP27597 WBGene00030021 status:Predicted UniProt:A8X5Z3
Sequence
MFLHKSLVLIGYEGIIYNHLKTSLLWNAQPPASRRHPISTPSRTTNRNRSGHLRGRNKDE
DEIENRSHSSSDTSSGSEQTSSSDDELEHSAHQPTNGLLLNAQPPASRRHPISTPSRTTN
RNRSGHLRGRNNAGSIQRRRKSPENSPVSTSVRGTSRGRSRSRGGRLHQSTPSSLSQNSL
NRTIAVSATESDSPPYPVSGRTSSASSTGTSRKTSRRINNGADVGTNQRSQLVGNLVEVG
ALVWDFVDRLVEKFLLPLLEKILQKITTGVVRHKIPEPLDDQFREEGDLVEELAEVYQFV
VSE
Download sequence
Identical sequences A8X5Z3
CBG08169 6238.CBG08169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]