SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG08317 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG08317
Domain Number 1 Region: 112-187
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000106
Family Cadherin 0.01
Further Details:      
 
Weak hits

Sequence:  CBG08317
Domain Number - Region: 316-340
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00739
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 198-277
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00873
Family Fibronectin type III 0.0074
Further Details:      
 
Domain Number - Region: 729-797
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 0.0751
Family Acetyl-CoA synthetase-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG08317   Protein: CBP31807   Gene: WBGene00030132
Sequence length 994
Comment CBP31807 WBGene00030132 status:Predicted UniProt:A8X6A4
Sequence
MLHGFLVFLLFLLQIHSVWSSEDVFDVRIHEGADKGSRLTMSQELQKSTEPLGHCFGQLE
TDVDWIEWKSSRSAFYTSAQMPLSATKNSNNLVGTLHLLCAGNQMHTFPFRVHITHRNHH
PPTFSRNSYKFHVPTTLPIGSVIGTLEVKDQDPVIYNSERKLAFTKDEPLVEILQDGTFK
LKSDLSVLTPYTPQRMQILLHVNVATEEYQIFEWEHPQYGTVDKYRLSIRRDDQVVYEEE
LEAAKTLALTKITFSNHMNVSFQVTAIDENGETSSEWTQIGPIDRDVVCKGECSRGGTPL
CYVGAFNRVEQFVDSRGAHCLCYPGFMGVSCETIDRCASERTVDVWGGVDWTEVNTNISL
LVPCPYNPVTENKFLERRCSWDSEAGRAIWERPQDRNSCQTQTSVLAHLGLIGTYSAKAA
TISAINTVTRFVRDLLSYPSFSRELSKHAHFDQKIAEMTALILDAVVQADLDRIPGNTTM
LRADAWRIIEAFALTLPTPYSLSSPDNGIHMKSIEWVKHAEPNDNLIGKKCRLQLPSTDE
SHVIRVVCASNATLFELLEPKSPVMSIKPDSEDPFGPTRMAIYMRYPDTHDNYTCVYYDE
EEKAWSTKGIRRIEHNYHGYVKCETNHFGVFALLPDRLFYNSESFWKDLASHMPTVTSFV
TLICIVLLLFMAAVQKNQPIDCAFLFYLFFVFMIHLSHLLLFLAPQVGEPFQFSTLLHFV
LQFCVIASSGLLCLVLYSIHTTIICYDIKEEEPQGCFSKPYHVFGMGILVPSLFTFTTYY
FLDGRDLDIARLFERTDWLFISNYLLPTAVLFSISIVYAVWNVYIASGTRTNRRCSSDRL
LALGPAISASVTSLFMVFFFCSALLLFFFREHSPMAIFFFCMFQFFHVVTAFFFASYLFR
LRFLLQQGFDSNDSTDSLERKRDISRALLEHVDTKSDIASDRVVIDGGFQDEGFAPPSHY
QYIPPGSMTHIDNNNRYMPMHQNIFERAPMVSIV
Download sequence
Identical sequences A8X6A4
6238.CBG08317 CBG08317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]