SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG08534 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG08534
Domain Number 1 Region: 298-334
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000524
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 2 Region: 204-242
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 3 Region: 381-415
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000969
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 542-584
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000157
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 5 Region: 458-499
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000733
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 6 Region: 509-540
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000458
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 7 Region: 272-295
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000262
Family LDL receptor-like module 0.0031
Further Details:      
 
Weak hits

Sequence:  CBG08534
Domain Number - Region: 354-374
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000942
Family LDL receptor-like module 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG08534   Protein: CBP34521   Gene: WBGene00030306
Sequence length 636
Comment CBP34521 WBGene00030306 locus:Cbr-egg-1 status:Partially_confirmed UniProt:A8X765
Sequence
MSSIAQKNRNYFLYIFYGRIFNSSDKTFFIIKKQLVIAPNFFSVDQKLICSSELFCGTAC
SRSLVVLYENYKKIVILNSPQFFAGLDSGRENQSPDGSVQGNGLKWMLFLCQKSKRTIFS
NHSNLFQCPSVAIVLVLALVILGVLAAIPLTLMLTSSAQKMSTDSTDLTDYSIRHPKFWP
KTDKIHFDDLGGIPMSSMFPPNVSTCSGFGFACTGAVHMVIPSSKRCDGFKDCQDGSDEE
NCKECQSVFSCRSHIEEDSKKKRKTKVQPTLICLTAERLCNGVQDCLDGSDEAMCKSTCS
KDQFKCNGSNACLPLSAKCDGVKDCSDGSDENNCNKCQKGAHVSLVSRNIKHLFASHVCD
GVAQCADRSDEQQCDCKTCSGSDKALCDDGTCIKRSQVCDGKKDCSDGMDEENCPGTCSI
EAFATKVKRVTCSDGKDYTESEACSGVEESCGGSCSKCHPKLTFTCPAAGNAQKKCIKRS
KVCDGIFDCDDGADEKNCTPVKECGIDNASQFTCDRKCVDASRRCDGVWDCEDKSDEQNC
SQCASGSIKCSADKKCLPAYTRCNGVAECSDGSDELKCSCEECLGAHSNTYMCSESNRCL
KRDEVCSPYSMCPNATYTDKAYCAALVLKNSGRFPY
Download sequence
Identical sequences A8X765
6238.CBG08534 CBG08534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]