SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG08746 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG08746
Domain Number 1 Region: 194-299
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 6.54e-26
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 2 Region: 504-622
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-23
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 3 Region: 29-166
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-18
Family Spermadhesin, CUB domain 0.0016
Further Details:      
 
Domain Number 4 Region: 645-764
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-18
Family Spermadhesin, CUB domain 0.0013
Further Details:      
 
Domain Number 5 Region: 348-486
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000916
Family Spermadhesin, CUB domain 0.0057
Further Details:      
 
Weak hits

Sequence:  CBG08746
Domain Number - Region: 779-821
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0186
Family LDL receptor-like module 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG08746   Protein: CBP36554   Gene: WBGene00030484
Sequence length 976
Comment CBP36554 WBGene00030484 locus:Cbr-eat-18 status:Predicted UniProt:A8X7A6
Sequence
MYLFHIIFLLLFISRSTEAISSNRKTIFQCDQHFDESQPEGVIEFPSLPKQLAISHGVNN
SKPEQQYNLQCVYTFVAGPRQRVRLEFDHFLLSGSSENCDIEYVDIYSEVESVDEDILQS
ALGGRYCGTVAPHVRISLRHVMKIVLHSRSTNHEDSHGFRAKYSFIPEDKFIAGEPVSGK
KCSYIIDSSDRKIGTLYSPTYPGTYPHNMHCSYLMKGYRGERIRLFFTDFDIFFGGEHCP
YDSITIFDGPTPSSPIIRKVCGLQQRMEIYSMTNSLLIHFNTTHPAKSDPRGFIMDYEFS
SRFVNIDKLLNKQRGVTHIRGTECDVRVESNRETTHTISSPNVSSLFLYYGNLYLFQYPE
VYPANTTCTYIIHGLQGEQNLEKVILTFDSIAVLSFDTSPATAPPSVDDIACPSAWVGIA
IGEGNMKAVMSSTDDSIFDVTLCERIPSDSPLLGPYISEGPRMVMQFGSTDTRDDRITPI
GFKATIEFKTDFGVTGESLGTSNECRFRFTSSTGFFNSPRYPANYPMDTNCTYYIVGQPG
KEILLHFEQFALSGDDDSNCNDYLDVYDVFVKNGKEELRLKERYCSDTFPGPSVSAFGSH
EMRVVFTSGSSGTANGFKALFEIRTARKEDVPRGEAHIRRGAYRCGSVINATADKPNGLI
ISPNYPVKYNKDVHCDWQINVKEGYQVLLKMEAIDVEGEMTSDSASCQKAVIRVEGAPRM
EYCGTKREFFEAYLSPSNSVRISFLTAPDKVNGLKGFNLSWTEVKNLSGKDESVCKSDSL
YLCTYSKLCIDAKLRCNGLDNCGYGVQDDTDEQHCDAKFMSTSSGWLHNRNNLLVILVAV
LLCVSFKLITLGLELPSKKQSFFNLQNNLGSLKEKSADQTIVVAAIFCGAIFLFICILFL
YLFKTKLDKKKKSKRKSDTKHRQRQPYRQQKPMHKPQFDSELSPPATSRFVHHDATGIMP
PIPLHQIGTSSRDMYS
Download sequence
Identical sequences A8X7A6
6238.CBG08746 CBG08746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]