SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG08830 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG08830
Domain Number 1 Region: 35-253
Classification Level Classification E-value
Superfamily L domain-like 1.22e-28
Family Internalin LRR domain 0.017
Further Details:      
 
Weak hits

Sequence:  CBG08830
Domain Number - Region: 568-632
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00519
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number - Region: 494-561
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0105
Family Myosin rod fragments 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG08830   Protein: CBP31962   Gene: WBGene00030554
Sequence length 641
Comment CBP31962 WBGene00030554 status:Predicted UniProt:A8X7H6
Sequence
MSEGEKLESERREEGEEEDKENLDDSRANSSLTNSTFLASGRIQNEKAEVTSEGVLDLTN
LSLTNLERNFHVEYAKVKNLAISGNNLQKFTYMKLFPKCEILDAQDCQINKFIADFNYNL
LELYLSRNQLKETNQLGRFENLKILDLSSNLIEDPVVFTLKTLEILNLSSNYLTEIPDLS
KCVSLRSLNLAENKIADLTVTGKLIGFEINRFFQKISNLISPTSLQKLDISSNSIDDLSQ
FSTFSQFKKLDDVAVAENPCIVEVVESDKFEYRSYIVACCSEALTSIDHEKIQDHIQTEG
EWLTLQGGIKKIGPGSHVALCEQIASHFPKAENGPPTPAQKSCHKALEKRRSMAVEPSGD
SSVRSEDTVNSVYSPFREWNGKIGKNLNLRRTPGSVGKNNLRMCSPPEARKNRSFTFQNS
ANQLESFIATPSPTQRLQESTRTTSTETVICSARTELSFTVDGRSESTPLPIIETPTKLP
ERQLTPSVAEVSFASDETEELKNRVRALEQKVTELSKQNETLTAINDALVDILETFKTEQ
ANMWKAIRSQIPTPQNMTNSLVCETEEGHHVHQVKWDMPLVKGYRIFVDGSSCGEVVGKN
QSARITDLTADEPHFVQIQPIGNNGESGEISKKLHIKPPPQ
Download sequence
Identical sequences A8X7H6
6238.CBG08830 CBG08830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]