SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG09244 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG09244
Domain Number 1 Region: 1870-2062
Classification Level Classification E-value
Superfamily Fibronectin type III 1.01e-36
Family Fibronectin type III 0.0021
Further Details:      
 
Domain Number 2 Region: 2079-2169,2533-2637
Classification Level Classification E-value
Superfamily Fibronectin type III 3.18e-31
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 3 Region: 3089-3297
Classification Level Classification E-value
Superfamily Fibronectin type III 1.16e-25
Family Fibronectin type III 0.00086
Further Details:      
 
Domain Number 4 Region: 2169-2261
Classification Level Classification E-value
Superfamily Immunoglobulin 1.15e-17
Family I set domains 0.0089
Further Details:      
 
Domain Number 5 Region: 2271-2351
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000296
Family I set domains 0.01
Further Details:      
 
Domain Number 6 Region: 231-328
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000321
Family I set domains 0.0039
Further Details:      
 
Domain Number 7 Region: 2353-2438
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000107
Family I set domains 0.012
Further Details:      
 
Domain Number 8 Region: 2993-3096
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000112
Family I set domains 0.011
Further Details:      
 
Domain Number 9 Region: 83-173
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000331
Family I set domains 0.0045
Further Details:      
 
Domain Number 10 Region: 1691-1777
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000496
Family I set domains 0.026
Further Details:      
 
Domain Number 11 Region: 1788-1876
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000805
Family I set domains 0.012
Further Details:      
 
Domain Number 12 Region: 3277-3376
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000333
Family I set domains 0.013
Further Details:      
 
Domain Number 13 Region: 2662-2740
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000616
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 14 Region: 2458-2547
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000365
Family I set domains 0.019
Further Details:      
 
Domain Number 15 Region: 2909-2987
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000474
Family I set domains 0.033
Further Details:      
 
Domain Number 16 Region: 1604-1686
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000039
Family I set domains 0.019
Further Details:      
 
Weak hits

Sequence:  CBG09244
Domain Number - Region: 23-66
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0281
Family I set domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG09244   Protein: CBP02422   Gene: WBGene00030863
Sequence length 3376
Comment CBP02422 WBGene00030863 status:Predicted UniProt:A8X9J5
Sequence
MYRNDYPVANFDKMAFEGFTKGSEHSFNVTINDIRKLDGGKLVFEAKNDYGVDKCTILLD
VRDSGSFIDDYSEIHRSAEIKDPVGDVQVKEGETATLTGKVDGYPLPELIWIKNGREIDM
MAPSTKYQLDYHSDGEFEARIANCTFEDDDDYSLLVENLAGVDSCNFQVFVDCKEYPDDE
HFNRRRRLQRGRRVVEASSDSELDDAKKRKKRRTKRVVERRNPNAPRLTQLIPPRFDKIL
SDHDAIVGDNVVMMVETLGEPEPQVRFYRDGKLIGDDSGEKVEVRHEDEMRKHWLILKDI
CKDEEAEYACQAINVAGEAWCFSDVVVHLSEESRDDDKSIDLAEEAVSQGEKSEAGEDKT
KQRAKKKVTKKKDRAETEKQDLTKGADDAKPLESEQVLEQVESETAVQKKTDDGDTFVEK
KKKKTSDVKKAKETDEATSEKKADEKAKKEADAKQRAEKKTLKQKKEATDAAPKTLEAKK
ETSQAPSSRESTPPSDGKKKKQIPKALFIPDEISSRFGDPSTMHSETNITTTIRGREGSA
DAKTPLVEPLSASVSMKVESAKEKAEFSFKRRSETPDDKSRKKEGLPPTKKSEKKVSQYS
HDCVWMVLLFFFRSLKIQTIQAFFFPLVMHESVIPRAHPALNPQILPQRTNALFPFFRMM
HRTTDAAVPLKDQKEVKSETEVKAKKDLEAKTKKEADNKAKKEAEAKTKKEADDKAKKKA
DAEIKKEAVTKKEADEKAKKDLEAKTKKEVDENAEKEAEAKTKKEADDKAKKDLEAKTKK
EAEEKAKKEAEVKTKKEADETAKKEADAKTKKEADDKAKKNLEAKTKKEAEEKAKKEAEV
KTRKEADDKAKKEAEAKKEADDKTKKGSDEKAKKEAEAKTKKEADDKAKKEADDKTKKES
DEKAKKEAEAKTKKEADDKARNEAEAKKEAEDKAEKGADAKTKKEADDKAKKEAVAKKEA
DDKTKKEAEAEKEAEAKTKKEADDKVKKDLEAKTKKEADEKAKKEAEAKIKKEADDKARN
EAEAKKEAEDKAKKEADAKTKKEADDKAKKDLEAMTKKEADEKAKKEAEAKTKKEADEKA
KKEAEAKTKKDVEAKTKKEADDKAKKDLEAKTKKEADEKAKKEAEAKIKKEADDKTKKEA
DAKTKKEADDKAKKDLEAKTKKEADEKAKKEAEAKTKKEADDKARKEAEAKKEAEAKKEA
DDKAKKEAVAKKVADDKTKKEADDKARNEAEAKKEAEDKAKKEDDAKTKKEADDKAKKKA
DEKANKEAEAKTKKDVEAKTKKEADDKAKKDLEAKTKKEADEKAKKEAEAKIKKEAEAKK
EADDKAKKDSEAKNKKEADEKARKEAETKKEAEDKAKKEAETKKEAELGKSDETKPKKRV
VKKKTDKSDSSISQISSADTSSEFTVQEKPAEKVEQLPDESTSATIKKAAQPQEPEVEKK
ELLSDDKKPVEGKPPKPEESDETTKKRVIKKKTQKSDSVASEASLADVSKISDDLEEKPK
KKVLKKKTEKSDSVISETSSIDTAKPDTTETVVKQEVTTDSAIESEAKESTKKEDEPSIE
DVMTRRKSSAIFSDDEQSISSKTSSEGRRRRRRTGFASTFASETLALRGDNVEIEVELVD
EEDKVTWKVNGKDADLNARCHEMTHTFFRTLIIDQVEPSDSGMEITATCGTESHTTTLKV
EELPVDFVKFLPRKTSGKEGQEVTISVTLNHPVDISKVVWLKNGKPLEINKDYSIDTVGC
SVSLTLRRAKYEDSGKYTVVCDGIDCSTHLSIQGKPVLKNVSEKKPVILVDKDDQFSIHV
AYDSNPEATFSMSVDGKDLEFDGRSRIDVVDDGLKLTKRGVSKDDAGEYEVKLKNEFGEV
TQKFDVKVNDTPSAPGDVSVVKVESDCLHIEWTAPAENNGAEVTSYVIEKKESGRRKFHK
VGSVNGKKTSHVIDDLEIETPYIIRIAAVNKFGTGEFIETKPVQTGSPFQVPTVESPPTI
ENVTSTSCSLNWPKPTDDGGSPVYGYDVYKRENGGEWQKINGDELVFTESFNVRALSSGK
EYEFKVEACNEAGLRSNSNVVSEKLMVQGLVPETILDAPMVKVLDNDKVEVTWKTDGENE
FVVQYKSDGSSIWASIDIGEAAAATSKCIIDGLREGIPYVFRVAPRNQHGTGEFSEQTVP
VVVLADDAPRVLKAIKPVKIPKKCELRLECHAAGHPAPEYIWYKDGKEIIPMDNNTEIVN
EGSMSALIIHELASEDVGLYKVLVENIHGTAESEAEVSISDVRAHFNSSFSELTEIEEGH
DIELTCEVSDEEAVVNWYKDGKKLVASDRVQFYAMARKRTLRIKGSTDADSGVYKCETTD
GRSRAEGEVIVNEQEPHILVGPQDAIVKTFGETMVLFCETSKPVRKVKWFKNGVEIWPQM
NKAVMDSDGKRATLEIKNFDKHDIGAYTASVSDKETSAPAKLAFEVAPSLTIPEEIREGV
TVHAGNEFDFTVAFTGFPVPTIHMANNGTPIKAIATVTEYDDSISVRMKNVTLDNSGIVR
VIAESPLGQCVKEIALKIIDKPSEPLDLQFKDVTEDSVFLSWQPPVETNGAPLTGYVIER
KGVDNNRWRPCGHVEPTKLTFVAEDLFCNQVYGFRILAVNEVGESEPCETVDVLTLESSE
AVSESSELFIPKIAILTTPQVTVAADGTKVTLRWDECPETSLYKIERKKVGESEWLEIAN
TDRNKFKDRSLTESGEYTYQVTATGIHAVSSPSEETEPVKILVPGSEMPEIKAEKKSEAV
DDSKTTVSTEKPKDSADLASEAVEEKKTKKVTKKKVPENKGEETLQEVKEKLKKGKAVEK
VQDESRRGSLQTSDAESVTTASEKKAESEAEKSAKKTDEKTGKSDAPEKTAEKSEAERSA
TEKDSTEKKKKVVKKVAKKGLVKADKSKVELISGKTGEISAHVAETAVSVEWKKDGKALD
ASYTVTNQGGVSTVKIPTVDVNASGQFTCKVKSSEGDEEEVSIAVTVKLPEIPKVEAEQS
VVEVKVGDTAKLSAKISEPATSVNWTKDDKPVQEDGNVKSQISADGTAQLTINKTDSGHA
GIYKLNVENEAGKGKVEIALRIKGAAKGAPGIPTGPIVYDDVTENTAEFSWKAPENNGGC
DITEYNVERKESKNKGWKQCGKTKELKFKVDGLEADTSYDVKVSAINTMGTGVALEGKLN
TLKKATEKKVEKVEIKEEKSEEKEQKTSDLKPIGKPELTSSTATSIALKWASDNDDVTYT
VQMKESNSKRPWSVAVKECSECAATIAQLKEGTTYLFRVIAQNKAGQTVTSEQSEAIECK
DTKESQKPAITSAPADLTAIKNTKSKITAEFTGHPSPEVHWFKNKKEIFSGKRQWIENVS
GVSSLTIGEMREDDEG
Download sequence
Identical sequences A8X9J5
XP_002636803.1.8413 6238.CBG09244 CBG09244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]