SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG09247 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG09247
Domain Number 1 Region: 195-473
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.07e-79
Family Protein kinases, catalytic subunit 0.000000148
Further Details:      
 
Domain Number 2 Region: 992-1085
Classification Level Classification E-value
Superfamily Immunoglobulin 1.04e-23
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 1738-1833
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-21
Family I set domains 0.0032
Further Details:      
 
Domain Number 4 Region: 1114-1208
Classification Level Classification E-value
Superfamily Immunoglobulin 3.04e-21
Family I set domains 0.01
Further Details:      
 
Domain Number 5 Region: 891-978
Classification Level Classification E-value
Superfamily Immunoglobulin 3.37e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 6 Region: 555-648
Classification Level Classification E-value
Superfamily Immunoglobulin 3.53e-20
Family I set domains 0.0075
Further Details:      
 
Domain Number 7 Region: 784-877
Classification Level Classification E-value
Superfamily Immunoglobulin 4.5e-20
Family I set domains 0.0073
Further Details:      
 
Domain Number 8 Region: 1215-1312
Classification Level Classification E-value
Superfamily Immunoglobulin 1.94e-19
Family I set domains 0.0097
Further Details:      
 
Domain Number 9 Region: 1638-1736
Classification Level Classification E-value
Superfamily Immunoglobulin 2.36e-19
Family I set domains 0.031
Further Details:      
 
Domain Number 10 Region: 2648-2738
Classification Level Classification E-value
Superfamily Immunoglobulin 1.74e-18
Family I set domains 0.008
Further Details:      
 
Domain Number 11 Region: 1324-1415
Classification Level Classification E-value
Superfamily Immunoglobulin 4.15e-18
Family I set domains 0.011
Further Details:      
 
Domain Number 12 Region: 2066-2159
Classification Level Classification E-value
Superfamily Immunoglobulin 4.35e-18
Family I set domains 0.015
Further Details:      
 
Domain Number 13 Region: 106-157,1430-1524
Classification Level Classification E-value
Superfamily Fibronectin type III 4.23e-17
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 14 Region: 1960-2057
Classification Level Classification E-value
Superfamily Immunoglobulin 7.69e-16
Family I set domains 0.043
Further Details:      
 
Domain Number 15 Region: 1533-1625
Classification Level Classification E-value
Superfamily Immunoglobulin 8.29e-16
Family I set domains 0.046
Further Details:      
 
Domain Number 16 Region: 2435-2516
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000105
Family I set domains 0.03
Further Details:      
 
Domain Number 17 Region: 2294-2386
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000108
Family I set domains 0.016
Further Details:      
 
Domain Number 18 Region: 1854-1948
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000198
Family I set domains 0.0043
Further Details:      
 
Domain Number 19 Region: 2743-2834
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000874
Family I set domains 0.044
Further Details:      
 
Domain Number 20 Region: 685-780
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000355
Family I set domains 0.0098
Further Details:      
 
Domain Number 21 Region: 2543-2637
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000141
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG09247   Protein: CBP30696   Gene: WBGene00030865
Sequence length 2897
Comment CBP30696 WBGene00030865 locus:Cbr-ttn-1 status:Predicted UniProt:A8X9J3
Sequence
MVRQIEKTALNTVLTINGIDSQDQGEFALKIKNRCGEDKYAIGIQMIKNEKKRYETTKSP
IVQHHLANQLSKIRILIQSDFDGQLRLTMEDLQFAITQLKCEKSKTWTKAEVTKQAFITL
FNLVPGENYTFRVRADNTFGQSEPSEESEIVYVKDNSRVLEEPKKKEVKMKEQESVDYQK
ISKEAGPSEYKTIDIHRLPNDLQAKYIIHEELGKGAYGTVYRATERATGKTWAAKMVQVR
PGVKKENVIHEISMMNQLHHEKLLNLHEAFDMGNEMWLIEEFVSGGELFEKILEDDSLMS
EEEVRDYMHQILLGVSHMHKNQIVHLDLKPENILLKAKNSTDLKIIDFGLARKLDPKKSV
KLLFGTPEFCAPEVVNYQPVGLSTDMWTVGVISYVLLSGLSPFLGDSDEDTLANVSAADW
DFDDPSWDDVSDLAKDFICRLMIKDKRKRMSVQDALRHPWITGPLLSAFNDLSEYVKKMQ
PKPDKSGIPARQKRNFLSLKRWSDDLLPIGRLAKRGAIFRRLTMDGVFERNIAFGESPTL
HLPIKMKFSDTDAAPSVKKQLEDIVANVGDLIATLSCDVDGVPSPKVQWYKDDKELTVPS
MKYDSFYNEGLAELTVKNIVESDAGKYTCRATNDLGSIMTHAKLSVKSDDKKKKKSETSP
AVIEKKKDRKTSKVVVVEEMIDMPPNFHHLLQDDEAKIGETKVLVVTNTTLPEPTVEWYH
NGEHISIQDSNYLQKHDKGRYELHILSVDSTDEGKWKAVGKNAFGECESEGKLTVVVPDG
QFAPSFGRQLSDVKCSESDILKLEVNIKANPAPEINWFRNEAEIEHSQRHRLQFDDGSGN
YSLTIIDAYAEDSGEYKCVAKNKIGKAHTVCCVRIEELLAKRSKKIDGSKAPRFRMQLPT
PREVPQGSDLTLVCSVSGTPHPNIRWTKDDQPIDMSNKQVRHENGVCTLHIIGARDEDQG
RYVCEAENIHGVAQSFSVVEIKEAVDKDHIKPKFLEPLVNCSTCEGNEIVLECCVTGKPI
PAITWYKDGLKLIIENRMLQYTDRKGVSRLNIMNVVMDDAGEYTCEAVNTLGKDFTHCTV
KVVDMGLAKTRLTPVRSRSRSRSRSPSVLGGDIQRPPVVTRPLADATVTEGNRELLEVEV
DGFPTPTIEWYHDGKLVAESRTLRTYFDGRVAFLKIYEAHEEHNGQYVCKVSNKLGAVET
RACVVVEGPHAAEHVTQMPTFVKKLQDVVLKSAGETATFTCQSYANPAAQVVWLHNGKAL
QQTNGNYKTRLFDDNTATLVIENVTDELCGTYTAVATNQFGDVHTSAQLTITGSEARKVA
ASLPYFIIEPKPKINVNEGATLSIQADLNGSPTPEVVWLKDNSELVESERIQIKCDGVSY
QLVVRGVGLEDEGTYTITAENEKGKVRQNTEVSVTKSKDVKEKKEKKKVEKKDEDKKKPG
RPGLPRPGASKTDQVTIAFDAPSEGPADSYEVERRCPDQREWTKCGTSKSLELEVKSLTP
NTEYIFRVAGRNKQGLGEWAEMMTTLKTAPSGQAPQFSILPQSKMIISRDDELEISVEFS
GNPTPSVKWYKENVQVVPDDKINIAATSTSSTLQSKSQEENGTYTCFIENELGQASASCQ
VTVFNREPSHQSTPDHSLERNLVPVVQKQLNNESVQAGQQIMLTCRISSRSGSTIAWFNG
DERIESAGRFELSSDKKSNHKLVCHAVQYNDAGKYRCVVTNKYGYAESECNVTVEDITKF
IAPSFSSTLSDSTAILGHNITLECKVEGFPTPEISWTKDGERISTTRRIRQIQDENGNCK
LIISKAESDDTGVYVCSATSVSGVDSTSSMVMIAKTTGTDSHLVIAQSIDDKQEKPRFIR
APPSLIEVNESGQFTLVAKAIGEPKPTVTWLKDGREILRTNRIYHHFVTGDGESHLIAEC
VVSKTSGIFSCKAENPHGTVIAETQVIVQKMKPASDLANVAPKFTIPLTDMGIVNGHPTT
LSCNVTGSPEPTLEWIYIDDSGNKTNLTSSTTSWTECRFGKVAELKSERVLREQRGTYQC
VATNSSGKATTQCYLLVGELSDEPAGPPRFVKCLQDTWTPLKESIEFSVELAGFPTPDLT
WYHNEKKIIEGKDVKITFPSDTTSVLSIKNVSLASLGMYYVEASNIHGVLRTAGRLNVSD
ERRKAEPPQFKHVLEPVLAVQPKVAFSEEHPRASSSAATARVKKGAAPMFLQGLEDMDLK
AGASAAVAGKLGRKLRPHRSTTNDADKLAKALAQSLKLEEPRHLMESRPESAANTALDEV
RAAINSRNKRVCRPKFMVKPKPKKVLEEYKSLRLKTAISGNPMPQVHWDKEGIILETGNK
YSIYNDGDFYYLEVHHVSTFDKGFYNCTAANNEGIITCTSEIDVLPNKEDSAAQVAKRRS
RKEAKAPNFIEVLPGRSQVYLPAKSGFYRVFYFQANLNESLCVECSVSAYPCASIIWTRN
SVRLLPQADRYTMSYDGECASLKFISVAPGDEGTYSCEAVNEHGTAVSNVSFKKIYPIKG
SPSMFQMNLLVSGMDPNAAEGIPPLFRFEKIKSVKKVVDGSRVELAAELVQASEPLQIRW
LRNKVTIVDSPSFSYSRSEKMVFLTIADVFPEDGGEYTVEAKNQSGIARCTMQLDVRSNE
RSIADEAPRVFDFEQTTRTDPGTSVELRAKIIGHPDPVITWTKANQKLNNEERYLMRNEG
DTFILRISNVTRADAGKYVLTAINASGQANAELELTVIQSTKTVGEKPKFNESPISVQTC
EKNRAELRASFSGTPAPTCRWFYSGNELIDGLDGYTISVSETDSSLLINSVDKKHFGEYL
CTIRNQNGEELANAMILSEGKITVCSLGISVYRPVSVFSLFVLSSSLFVVIGVVQVYIAR
LLHFLNKERFVGRNIFA
Download sequence
Identical sequences A8X9J3
CBG09247 6238.CBG09247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]