SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG09359 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG09359
Domain Number 1 Region: 115-153
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 2 Region: 154-190
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 192-230
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000327
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 4 Region: 235-267
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000484
Family LDL receptor-like module 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG09359   Protein: CBP34235   Gene: WBGene00030957
Sequence length 538
Comment CBP34235 WBGene00030957 status:Predicted UniProt:A8X9A1
Sequence
MDNHIVLFLMSSGALFLAVTGNGMEQMMTAEGPISPNFCNSSDILEEAGLIKSTLGQFLG
YECSEEFYHCRWQSDGFRTYRKKCKPGLVYDVLGTQNCNYDYNVKSCGVRSGGPVQCNGT
DFYCSLSEQCVPMSSRCDGHYDCSMEEDEQNCPLCTAGEFACKVSEQCISLDRRCNGLIE
CDDGTDERDCDVCGHGLFHCGKSNECIPMDERCDGRRQCPHGEDEMLCKKPEMEKKFTCQ
SRDYEIPTNQVCDGMPQCPDGSDEAYCEYPGSPKSQTAISFSSNLTPVSESRPAPPLPPA
PQQPEPEETEEDYDYEQIKDENAPAAFPMISLVPLPPTTTTTTTFVPPTTRVMTRVPAPA
TRVAKPAFSRPRPKLPSTDDNRPTVNQKTVQTTNTKITRPPKVIQTSRTSLRITSQTLPP
TRQTTNFEKKMPQAIVQPPRSPALPQPKEEKVFIMQVTASPSVRPPLQELPRASSGSRAV
SKALPVKVPGADNDNILAQITSQLNGGMSPELLAKIETIIKSEMQGGEPRHRRFQPRL
Download sequence
Identical sequences A8X9A1
6238.CBG09359 CBG09359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]