SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG09377 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG09377
Domain Number 1 Region: 705-1016
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.78e-74
Family Protein kinases, catalytic subunit 0.00000166
Further Details:      
 
Weak hits

Sequence:  CBG09377
Domain Number - Region: 149-232
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000658
Family Fibronectin type III 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG09377   Protein: CBP34761   Gene: WBGene00030973
Sequence length 1082
Comment CBP34761 WBGene00030973 status:Predicted UniProt:A8X985
Sequence
MMTHGDHHSVKSVNHQAKMLTFCLTFENVCFILFGLPTRTFEFLFKYMCPLLSFLSNLFL
SVSFALLQIHSISLFSWYLNLFHCNYFQNGYLCKSNETSINYIYIRTNASAQQSLETCKP
QCQKFNNDNLCIDNTCWSTCNGELVPEKTLPAPSNLTLKGVRGLQWNDVPGAVMYYVGYR
TMSSKKFTNDDFVITEKQSVDLSTLTNIDPCSELEVTVAAFSEDGIGNESKELKISSPKP
TANPKLDLLEMEYFNTTLVSDFYTANATVHVEFRYKTDPWFLGQDDLDVMPLFHLISCVD
PDLSQGIPVPDFMVHVENSTISTSIGSDMMERKCRYVYYLQSVTSKKCNTMTEMPSPPSS
ALQTIQVDCDIVKNAPCFKVPSYPSPICGMVDNVAFSVVARDRENLNDPASNLTVNVTFK
PVTRTNELPTLYYIGIYGAAMEFNTKEEEAFLGVNITNVLGTETSCKSFDRSGSCLAENV
NRSIVLQGIHPKTLYGITICAVKDLRNLTLPDLTIDSKSVRPRAAKIMLVEHSHYSFSLV
PYQLLIQPDGFSHTNTNKDSVISRSQRHLDYDFNNTTEFVERNETGSESFGTNGTNGTDI
EEYQLDNSTILFTNFTTELTPDDFENFTTTTPATTTSTRLPPSPNQTGMIIGIVLGSLAI
IGLAIPGIWYYFRWKSDKKLKFKMGQMGKSNYHGNPYTDFPIFAANKNDIWEIERRNLII
HNDKKLGSGAFGAVYLGGKTNWKSLAHKDANSPLGINLMRAENCQVAVKMLPEYADEMSK
HEFLREIALMKTLGYHERLVNMLACVTESEPLCLVVEYCDNGDLLQFLRERCKYMMKLDD
LGINYHDPPENDNYDTNMIVTLKQLLQFAVQISYGLEYLSQKGFVHRDVAARNVLVHEGT
ACKIGDFGLCRYIYADQSQYKSKGGKLPLKWMSPEAIRHYEFSIKSDVWSFGILLFEVIT
LGGSPYPGMPPEDVLPHLESGGRIEKPDNCPENFYDVMIQCWSADPEERIEFSDIRMQLA
TQLEDITEDYSYLKLDAAKDYYNVQYGDEKVKPEVVIIPDEIIKPSKIIMDELSVKNLEI
EH
Download sequence
Identical sequences A8X985
6238.CBG09377 CBG09377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]