SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG09666 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG09666
Domain Number 1 Region: 146-474
Classification Level Classification E-value
Superfamily SET domain 9.29e-54
Family Histone lysine methyltransferases 0.0011
Further Details:      
 
Domain Number 2 Region: 1090-1172,1224-1373
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.3e-26
Family Protein kinases, catalytic subunit 0.0015
Further Details:      
 
Weak hits

Sequence:  CBG09666
Domain Number - Region: 692-741
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00267
Family Fibronectin type III 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG09666   Protein: CBP34664   Gene: WBGene00031221
Sequence length 1384
Comment CBP34664 WBGene00031221 status:Predicted UniProt:A8X8I7
Sequence
MMSAEETMEALREFAPQADNMTQYLTSNVETSQPLPFDVDHGFAEYIKANCYDKRRSVVK
NSVKEVESDELKQQISAHGEMIEKIKSDPELNSNYRFDAIYNEEKMRQICRVLAQRTMIS
QGRIVEISTCGEDRNIKVPESILDYQTIYFPPEKRIQIMKNITFNKKDVIPVYSDIAGET
VESISIPNSLLFDYTDVNYFNQTAEHNLARAVKMAAEDKNTIKCSCCSSDPDKKVIRCYE
NRNCPCFIMNEKLQKFQKPTNGNSPAKFTSFEPIHFTSTDRHFYQHMGFACSELCGCEAK
CTNNVLMIPNKRLFPVEMFRSNEKLGFGVRSNVLIPAGTPVTEFVGEIIGEQIHMENVNW
NNIEYAYQVTYGEDDVMKQLVDQATFSKNYKSLIKDLYASISYYLDPTVCGNYARMASHS
CAANMELVRVFQKSLSPAHIHLVMVAVTDIFPGTPITIDYGNDYATRLENKCQCGTFACL
NGPESREMKNASHAEFGDSQTVRTNADTLYREINVVNNTEYSLCRLGCTHPEFETLSLPE
FTFGQSAYREIVDNQTSAKSEEVQKNIVKEVRFLCLDHQDEGFTGRVNMLFEKDVEESNH
IHYVELISRDEGDDEEVILHHSWCYNSNCYINFNNTFLVDFRLRVSAFNGNGAVGRRLSK
WYNARNLLSVSNDLSLKSVEWKDDKAVARLSPDSNSGIPACSYEIQYKNALSSEYTTVKF
YLDHTNELLVRGLEFNQNYTVTYISDLIGELVSVDVSVPACSLMVTDVTMCAPPSVSSLH
SRWNTSSGENDLEIDWNYFWVLDANTNRIDRSIRTSHFHITVHPLITPNNPNCEKYEPIR
RDVDNLQRHVSFRISDAKCNYEVEAVVFDTKRRKSETKKMKIVRINEPSYMALLPATDVQ
TTIGLVVLLTCAIIFFTLIILIILLKKRNQSRRRRRGETVCYAYVDEPSRKIVGVRQPGA
RFLPVENMNRDVEAGLAQRTVGCNIQNGPKVNMFQVLPQPPYGDSTSDHHYDYISEYQVE
SEMSDEVFEEDICISTPNTPYRIMDSPSFCLMAPIAPFEEFDDLPAYAFQTFRFGKPYER
PGNPYCLMTTAMDVSRGNCFSLKYPRDYSEPTRRALRRELEILRILPLHPNIVHFNGVVI
GRWENIPYQITGILMEECLGGTLHDYINSAGFVLRRQGMRTPDDVCLPIANESPNQSSGY
NSFTSKGRQTPEQKTNQDKNSCQIVSSKFIGFAEQISSALEHLHFVRIIHSRVSSMSIFL
SCDFTDPLEMPSEQIVKLGDFSNAFPNSNDASVLDPMLQPPEVMMGKKFETKGDIWQMGM
CLVEMCTLGTPFAMQKHIPMSGVSEFDKLPSTRFIRDTAKKCLLKPRSRPEAANLRVNIS
NYTG
Download sequence
Identical sequences A8X8I7
6238.CBG09666 CBG09666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]