SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG09798 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG09798
Domain Number 1 Region: 1201-1415
Classification Level Classification E-value
Superfamily vWA-like 6.82e-50
Family Integrin A (or I) domain 0.00026
Further Details:      
 
Domain Number 2 Region: 1821-1952
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000698
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 673-705
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000357
Family EGF-type module 0.075
Further Details:      
 
Domain Number 4 Region: 136-170
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000393
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 5 Region: 1618-1650
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000553
Family EGF-type module 0.025
Further Details:      
 
Domain Number 6 Region: 531-567
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000974
Family EGF-like domain of nidogen-1 0.079
Further Details:      
 
Domain Number 7 Region: 1965-2003
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000113
Family EGF-like domain of nidogen-1 0.046
Further Details:      
 
Domain Number 8 Region: 103-135
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000148
Family LDL receptor-like module 0.0047
Further Details:      
 
Domain Number 9 Region: 3335-3368
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000158
Family EGF-type module 0.024
Further Details:      
 
Domain Number 10 Region: 2370-2402
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000172
Family EGF-like domain of nidogen-1 0.042
Further Details:      
 
Domain Number 11 Region: 33-67
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000196
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 12 Region: 1658-1820
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000204
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 13 Region: 1128-1160
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000348
Family EGF-type module 0.066
Further Details:      
 
Domain Number 14 Region: 1081-1111
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000048
Family EGF-type module 0.018
Further Details:      
 
Domain Number 15 Region: 430-462
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000731
Family EGF-type module 0.034
Further Details:      
 
Domain Number 16 Region: 2024-2054
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000798
Family EGF-like domain of nidogen-1 0.056
Further Details:      
 
Domain Number 17 Region: 171-211
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00008
Family LDL receptor-like module 0.002
Further Details:      
 
Weak hits

Sequence:  CBG09798
Domain Number - Region: 2320-2352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000106
Family EGF-type module 0.055
Further Details:      
 
Domain Number - Region: 3378-3417
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000119
Family EGF-type module 0.048
Further Details:      
 
Domain Number - Region: 885-1009
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000188
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number - Region: 770-803
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000322
Family EGF-like domain of nidogen-1 0.025
Further Details:      
 
Domain Number - Region: 2472-2499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000599
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 2731-2759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000923
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 2121-2154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00106
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 2521-2555
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00112
Family EGF-type module 0.051
Further Details:      
 
Domain Number - Region: 2676-2712
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00125
Family EGF-type module 0.062
Further Details:      
 
Domain Number - Region: 2162-2300
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00132
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number - Region: 67-101
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00151
Family LDL receptor-like module 0.0043
Further Details:      
 
Domain Number - Region: 1544-1649
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00165
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number - Region: 3074-3178
Classification Level Classification E-value
Superfamily SEA domain 0.00235
Family SEA domain 0.011
Further Details:      
 
Domain Number - Region: 3232-3265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0024
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 521-678
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00502
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number - Region: 2898-2955
Classification Level Classification E-value
Superfamily SEA domain 0.00562
Family SEA domain 0.018
Further Details:      
 
Domain Number - Region: 1179-1211
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00629
Family EGF-type module 0.037
Further Details:      
 
Domain Number - Region: 714-752
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00655
Family EGF-like domain of nidogen-1 0.074
Further Details:      
 
Domain Number - Region: 389-516
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00847
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number - Region: 2778-2807
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0086
Family EGF-type module 0.04
Further Details:      
 
Domain Number - Region: 3281-3312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00999
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 1431-1577
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.013
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number - Region: 2626-2657
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0165
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 839-875
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0176
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 3184-3217
Classification Level Classification E-value
Superfamily EGF/Laminin 0.022
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 2576-2608
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0272
Family EGF-type module 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG09798   Protein: CBP02463   Gene: WBGene00031318
Sequence length 3770
Comment CBP02463 WBGene00031318 locus:Cbr-mua-3 status:Predicted UniProt:A8X9N5
Sequence
MQAGTMLFLKLFIPITIFYPSIYCSNSTTTQICVARQEFQCKIDRSCISMKKWQDGVDDC
YDGSDEVCLPWQFDCQFGSPRCISKNKLNDRKIDCYSGFDEGCPAHYFVCRDRSACIEPA
KYLNGVADCIDKSDEPCAQNQFQCADGTKCISKSQFQNGKEDCDDGSDEECTTSQFACQC
GRVRCVAESFIMDGNWDCEDGSDEFINKTIAANCTRNNKVNIATSYLSLGKLKFCSGKNP
CKPELGQACVVIGGTWRCVCKLGTFRPLGSEKCIPIELLTRYRNAPSSNCSITIEEQFGL
LNGFRKNDISKTQLERWSNIRRAPTRTLSGTTPGNSGSDGFLESGTERIPFMFQEEEKNY
VSVIPDEIIDSYGTIMTPPELKFNRDDIQCGNKTCGLHERCQRNKEGKYECECAEGFTMF
GGTCQELIDECRQAKHDCHPEARCVDALIGYECLCREGFLDTSVEPKTRPGRKCRKLVNE
CTNASQNDCHQNARCLDKPIGYTCRCQDDYVDVSSQGARKPGRNCTKAINECALNLHNCD
PHAICQDQPIGYSCRCPFGFIDASTTAMEPGRKCVTADESINSTKTSQCFKNSSGDTVCQ
CLPGYTNFGSKTHLDCQPEKRANPCQDYSLHDCDPVAECFSEQPGYFQCQCPKGFTDAST
DKRFPGRKCVRAVDECALGRHTCDPHADCIDTHQGYTCKCRSGWSDTSLDPLRNPGRNCR
KADMCSNIDCAAEAECRETPIGPMCQCVSGYVDVSRQHGRPTGRVCRAVVNECAEGRHDC
SSHATCIDTADGFTCRCKDSYRDESADTVKHPGKVCVRTVIPDPPECDVSDPMSCDPGKR
EVCIFVENTYKCRCANGYSRLPDGRCVVINECAEPRLNSCGKNAECIDLAEGYTCQCRSG
YADISPASQPGRICRARVNECSNKEKYNVDCSENAICVDTEHSYTCRCRPGFADVSASFN
KLPGRRCIEAINECASPSLNDCSKNAFCEDAKEGYICSCRPGYVDNSPNAARHPGRICTK
PVEQIKTDLKDTSFSTDDGCDPKHPKCGANEACISRHGQHTCECIETAFRYTDGSCRVYS
ACSKINSCDKNAICLNRFDSYTCQCRPGFIDLSADLANAPGRICKELINECASSDNECSP
YARCIDATNGYACQCLDGFIDVSSRYNKPPGRHCTNSNNECSEKSLNTCDENADCVDTPD
GYTCQCYGGFVDVSSNANLPPGRVCTVQTTCPKQKTDLVFLIDGSGSIGSYVFKNEVLRF
VREFVELFEIGRGKTRVGLIQYSDQIRHEFDLDQYGDRSSLLKGISETQYLTGLTRTGAA
IQHMVQEGFSERRGARPQQNDIARVAIILTDGRSQDNVTGPADAARKLSINTFAIGVTDH
VLASELESIAGSPNRWFYVDKFKDLDTRLRSMIQKAACPSPTKQETPIDDVCNPRTQTGC
DRSLNEHCAVDGGRPRCVCPEGFTRHPLTRVCGGDLCNPQLITSCIFPEECQITPYKNFR
CACPDGYNRDYRSGFCVSVKEVHISPQHDANCHNGGLRCSENERCTNDGSDWFCECLPGF
ERIRNGQCAYPGSCNPNDPMSCDVRKRQQCLPHGNIYTCQCGRNERRHPITDICLKNECL
TGEHDCDRSARCIDTDESYICACLNGFIDHSPNPAERPGRVCVALQNECLDGSNRCSPNA
LCTDTEEGYVCRCKSGFVDYSPNPQTFPGMVCKELVNECANPRLNQCDRNAHCIDTIEGY
SCICKPGFVDMDEFGNPGRRCEKIKTNDKCSAGKNDCDRNARCIQVGDDDYSCACPPGFK
DKSPSPSRLGRLCIPVIPECDNPTLNDCDSPDRAICTDTDDGYMCRCRQGFLDISPSILV
KPGRLCKPLQNECALGADDCARDGGICEDTPDSFTCRCAMNYLDVSFDRVTRPGRKCKRL
INECQTGQNDCSEEATCTDTEDSYICACPQSHIDLSPDTINRPGRRCLLRINECTSNRHD
CSPNADCIDTPESYKCRCRDDFVDESPDTSRRPGRICRPALLDECRAQKHDCHVNAICQD
LPQGYTCQCSQDFLDVSPHRSTHPGRLCQPRPTPPPPECRLDGPNQCKVHLNEVCRIIGG
EPKCSCPVNYQRDSSGSCSVINECLFAQLNDCHTAADCIDQVQGYICQCKNGFKDIGDRK
RPGRMCKPMVNECQYPHLNDCHQHASCIDLDEGYECKCNQGFMDHSHGRPGRICKQLINE
CSRPSLNSCDRNARCIDKEEGYDCECRDGFIDVSPSPTLKGRACRELVNECANPRLNDCD
KNARCKDIMDSYECDCPVNSKDISPSPSFPGRVCLMFINECETGVHDCDPSATCRDNEQS
FTCECPNGFVDRSPNKLARPGRVCVKLVDECREGRHTCSNHADCRDLEEGYTCECRDGYV
DRSPNLASQPGRVCSAPEVCPPDHDCSSAAVCEPLGGMKYQCVCIQGYVDQSPGSQKGRV
CVRNNACHDPRLNTCSRNAICYDEPRGYRCECKRGFIDRSPDSSQRGRVCEPPPPPSPPP
RHPCQDPERNDCHPAGTCRDTGAQSYTCECLAGYADRSPSPLAKPGRLCVLTEPICLDPE
QNDCHAAAICSEVNDPEKYTCKCRDGYTDESPDPLRRPGRICKGMVNECLDRSLNDCHSL
AVCKDLPNGYTCQCPINAKDQSPDPRKPGRICSLSVNECANPSLNSCSAFADCIDQENGY
KCRCRHGYHDDDPSHPGHRCSFMINECDSSNLNDCDRNANCIDTAGGYECTCKAPYRDEG
PPQSPGRICRLNECLDSNRNTCDRNADCRDLDYGYTCTCRHGFYDQSPNPQEPGRICIEF
QQEEHIERVKVTTVQSEPRREFPCGRDDCIKARGEVCISGEYCGCKPGEGRSASTGKCQP
VQENPFELRVVTRDQRPLMYSTEFGSQKSPAYVEIVELFEKNMARTFGGTSLAPRYVNTK
VDYITHPKTKNSSWDQGLLFKYEVQTTKSQNQPIDECELWKQMQASLDRTNGAIGGGSLR
VASDTDLLNPCKQQEEWGNCGGMSCREHLKEICIAGHICGCPNGMKRRDANSECRVVESW
NVPLWVVRDKEKPIVFSESFDNPQTPVYKDYSKRLEKGIEGCYPHTELRNAFVTAEVNDI
VNPVLLNASYDTGLMFNTTVHFRKGMVHVPSDAYYQLVKYITKENNNEVGDSELYLNPTQ
PNPFNPCFKNDCDPHGKCIETSKYTYKCECGVGYRDINPQTPGKKCLPVHGFNECERKED
NECSENARCIDLEHLYKCECLPSYYDNSPVGSVPGSLCVLDYCSDVNFCPTNTTCKNMEQ
QAECKCDPGFMDIRKSEKRTALMLGDDTLCMHVRDVDECALGLNNCSGVAHCIDKAVGYT
CKCPEGYIDGNPDEPGRVCGALLCDLCNAHGDCVHNTATNNITCVCTDGWTGPQCQVAPS
NASLVLLILLALLFLLLTLCCLLYFCTKCHCFKGRPFAGAGANGFGYRRGGAWPWSTLEG
SSSSESGAMSAAGNEYYPDMMGIPRAKLKSGGMMASGAANESRSMEVARLDQYLDENAVR
IPRAHLVDGHGEHSFDSMSEASSEYTIKEEIERKVITDVTTKEIKTTTTTDEQGNTTVTT
TEAVHPRDTTVIHGGGYMQNESSSSSFSGGERIYQSQSSQQQQQQQSMAQSMAQRATSAG
YSSSGMESSAHNSGYSIRNTGERERGDSVEEFSIGRARGMTAARGYEHTSSENREVEEYC
SEEEDVEHSVGDRRTIVNKSHSFEPFVNGESERYKTEVVTSQTSTSVTKK
Download sequence
Identical sequences A8X9N5
CBG09798 XP_002641504.1.8413 6238.CBG09798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]