SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG09834 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG09834
Domain Number 1 Region: 2528-2723
Classification Level Classification E-value
Superfamily Fibronectin type III 9.28e-40
Family Fibronectin type III 0.00054
Further Details:      
 
Domain Number 2 Region: 1304-1501
Classification Level Classification E-value
Superfamily Fibronectin type III 2.58e-38
Family Fibronectin type III 0.00083
Further Details:      
 
Domain Number 3 Region: 1916-2119
Classification Level Classification E-value
Superfamily Fibronectin type III 1.79e-31
Family Fibronectin type III 0.0016
Further Details:      
 
Domain Number 4 Region: 2122-2316
Classification Level Classification E-value
Superfamily Fibronectin type III 4.39e-30
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 5 Region: 2335-2529
Classification Level Classification E-value
Superfamily Fibronectin type III 1.76e-26
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 6 Region: 3205-3358
Classification Level Classification E-value
Superfamily Fibronectin type III 3.45e-24
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 7 Region: 3047-3246
Classification Level Classification E-value
Superfamily Fibronectin type III 1.11e-23
Family Fibronectin type III 0.00089
Further Details:      
 
Domain Number 8 Region: 1121-1301
Classification Level Classification E-value
Superfamily Fibronectin type III 8.2e-21
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 9 Region: 143-316
Classification Level Classification E-value
Superfamily Fibronectin type III 3.57e-20
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 10 Region: 1727-1917
Classification Level Classification E-value
Superfamily Fibronectin type III 4.76e-20
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 11 Region: 1509-1552,1580-1703
Classification Level Classification E-value
Superfamily Fibronectin type III 1.54e-19
Family Fibronectin type III 0.0045
Further Details:      
 
Domain Number 12 Region: 2840-3038
Classification Level Classification E-value
Superfamily Fibronectin type III 2.29e-19
Family Fibronectin type III 0.0034
Further Details:      
 
Domain Number 13 Region: 3369-3557
Classification Level Classification E-value
Superfamily Fibronectin type III 3.18e-19
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 14 Region: 921-1103
Classification Level Classification E-value
Superfamily Fibronectin type III 3.75e-17
Family Fibronectin type III 0.0045
Further Details:      
 
Domain Number 15 Region: 2718-2832
Classification Level Classification E-value
Superfamily Fibronectin type III 1.34e-16
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 16 Region: 438-651
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000132
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 17 Region: 702-863
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000517
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 18 Region: 3574-3647
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000106
Family Fibronectin type III 0.0042
Further Details:      
 
Domain Number 19 Region: 31-112
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000353
Family Fibronectin type III 0.0042
Further Details:      
 
Weak hits

Sequence:  CBG09834
Domain Number - Region: 3670-3763
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00711
Family Fibronectin type III 0.008
Further Details:      
 
Domain Number - Region: 337-412
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00778
Family Fibronectin type III 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG09834   Protein: CBP28543   Gene: WBGene00031351
Sequence length 4544
Comment CBP28543 WBGene00031351 locus:Cbr-let-805 status:Predicted UniProt:A8X9R7
Sequence
MGLRSRGLLLLSLGIWYLQLFTVASVALNSNVRVKRQSGTDSLLTVEWEGIQTGDHADSE
VKGFLVEYRPERSGEWQLHPGIIPYKGPNHQYRVQIPKLPTGISYLVRIKVIGENNEVLV
ETPEIRAHNEIVSIKCENDDLTAPRYPVVTEVAQYSLAIKWDVPDCGVVGDYQVELTGVS
APFDVHRQTVTQPHVSVTNLLPGTFYSVKVRAVDRSRNVGPWNSEVLEAKTKGDALPISN
AIQLLYRTDSELRVSWQPFMDPRLQHYEVTAVEVDEDSRRVERRRVEPALSSFALTGLRP
STKYTIGVIAFVDHEPKQVYQIEAYTTSGGIESWEEKPQVVDQGKQQFAVHWKLPATSIT
VSKFILEYRLPNETTWRTSEQKGVAEGSGDYSVALSQMTAPYYTVRIVAIDDQNKVVART
EELTVGEAAESSCVGSAGVPTNIRSTDVDSESIKLEWDVPQCDETHTPIDGYEYIVYEAS
QNAPAKGASYVGAPHVIIRGLRQNVDYTFKVRSRSVNGHSQWSKDVIIETAIAGSVSSGE
LGELNQLLRVKRQAKHLIKDPLNIFKLRIVLSPPCSYLVWTPLTLHSQIISKFKLMYKEV
SSNKWIKLVGGPDHFECPRGIADPEDYCYQLKGLFFGVHYISSISYQLTNGEELPSSNPL
HFTLVQLDGSASSNTQGVTITQPRIEQSASRSVAYWSVIGDRSTVAEYQVDIRTTDERSW
RAVEPSVENEQSQTHYRLPLGQLNVASTYLVRVRALDSSRSTVATSPSASFSVLCQVPSA
PENVRLERVSDQTVRVSWESSQESGDCQSYFFITGKQNGQSINQRVPGSDRSVDISGSSQ
GDWRVQVRGVNTAGSGTPSRDAIFSSTAQQSTRQKRSVCDPRTDFWCQGQFSNSPLRATD
SGEGAVNRVWSLVSTPRVLAQDNDLIVKWKSEGEGRGVYGYHVQFRSENSGWKTYGQLVP
YVGDNMEYTQTLTGLERGNAYFIHVQVLDRNSYVMYTSAQSSAKSSCSPPTHTPSHLQVA
APDASHVRVSWALPPQSTWGCSDIQFEIQPEEPRGQPAVVLGSHQTSHIFNSAPNQMWSV
KIRAINSAGHSAWTPASQAKTPPGGELIIGPDVNYRQGKPIISWRSKEHTNDLIESFVLE
WKATTEQNWRQHRNPIPYNGWQRPYSVDLGELPQGHTYQVRIVAKDPNRGNAYTSSVVQV
QTQSQCKAPRRAPADVQVSPLGPTQIRVQWAPLHESEWNCDRLWYIVKYSTPQNQGFKNL
TNGENFVVFDSDPYTQWNFEVQAANPAGESQFSRAQSAQTQGVAPGAVANLRVQPIGPDS
LQCSWQPPMNPNGRITQYEVTYQLISRGNCDNNQEAPRTITVNGSHFTITGLHPHSKYRV
GVAAKSDVGAGERVSLEIQTDQAAPGGAPLYLRTEEIRPTDVSISWQAPPCLQTNGEITE
YEYEVTAGDRRQTVQKTTENIRGTRARIENLQPQTRYNVKVRAYTARGPGPWSTEVPFQT
SAGQQNVQAPGFVKVLHTGANNAQLVWQSPYPNPGYVDKYKCRYAPTGTQQFQERQFPAV
SPCQQRQIERQNLPQSPPGARLHCGRIENLKPEQTYDFQVSAHVKDSGWGPYSPPERTKV
TDSAVQVLYVRKIGGSENSLHINWDVRPDDKNRVTAFKIVVVPQDGSQRAQTFNVDRATY
QYRIDNLRPRTTYNVTVSAATHKEMCGGTAAVMTTDAAALTALSMAPRVIAEEPTSITIE
WESRNREAGGFIVEYRLEGGAWQQYNRRIPAHPSQTTYTATVDGLPTNAVVDLRVRVVSQ
QNEQSNPSPEVRARTKCSPPTSPPQGVRVDAPSTNEVRVSWARPAKNTWMCDQMNVEISY
RVGNQPEKILTVPGDQTEYTFPAEPNQRWVVKLRATNQVGSSQWSPEQSITTRQGAPGSV
RDLRVKALSPNEVHVQWLAPLVQRGTIVGYDISYRLKHRLACPEEEPRDVSRDFVTVYNH
KDLDYTITGLLPYSLYEVRVRARTTELGPEETKEVSTEQQPPSSPPLNLESTYALERSLS
FQWEPVDCSQRHGHIVNYEYEILGQDDWAKLERQIANTSDLRVTIDGLTPYTKYVMRVKA
YNSIGGGPNTENLVVMTAKAQAPLPPQDLVVAQEGTDFFMVSWLPPYPPYGPHDAYKIRY
QQIPSENWIENEKGVKDPLLKCPGESPRFCYNATGLESGQQFKVQVATRIEGGSYGPWSS
LVIANTLQVLPDAPRAIHLIEKTDHSLHIRWIPPVDPKGYVTQYRVSIVSLDDVNDKKRT
QVVNHPTLTHLFEDLNPETSYNISISAGTKQGFGREIWTRYTTDPFNIPVVGTMPTVTPD
GANALDVQWNAVLDPKNRVKGYIIEIRNSDTPVWQEIGGVTNHDSVKSTYFKKLTGLDSD
TLYFVRIKVVDHRQRVGVPSPEAQARTGCAAPLSPPTNLNLASPSNVQVRVSWQAPNQNS
WKCSAIRYKLEYINGTQPRKQIDLPSSSIEHLFDSKSNTKWIVRIRTENDAGSSEWSKEL
EITTAEGAPGAVEDLTAKPKGPTSVVVRWKPPRDPNGVITGYTLTYKLKSIGECGPRSAA
PIEKHVRNEEQTLEGLLPDSTYEIHVVAHTSHAGPQSSVVTVTTEEAAPTGPPQNVRVGS
ITSSRADVTWAQPECEQRNGKITDYEYELWSMDTWADNSTGHNPTERLNLDQLIPYTQYQ
IRVRAINKEGEGPFGEWVPFTTQSTNPPAPTDLQEEATFPHAIEISWLPPTPPHGNVDFY
KVRYTPTGEANYREIRVETDRLECSDSNKKDRLCYRLSDLDPEQEYDIQVSAHTEGGGWS
EWSDELTSRTQQQNIPVLERELEVTDKTSNSISLKWEGLPQDQATHVVGYVLEFKSEDDN
AEWQEYNGVVKHRKSTQDYKITVKQLETATLYFFRLRVVGKNDKRGQPGPETKETTSCGK
PEVPPEGLKLESLDFETLKITWTPPDESTWRCDNVEYLIDFVNTTSRGNWTVSTDAPSEL
IVPTQPGTKWDVKIRTQTVEDMGKPQFSKWSDKVSITTQSLPGEIFVTVEPKGPREALVT
WELPDKDQKWNYGVDITYKLKQLGGCNEVQTGAKEPVTLLNVQEKQIPLENLQPGSLYEV
TVTPRRPPSLHSSIVTPKTVRTFRTKNDVPTGPPQNLQSTVRKDSELGFKWDAPECVQQN
GNITQYEFELVGLDEWNEGTREGVTPRQNTLIDQLQPGSLYRIKVRAYTAEGPGPWSDSL
EIRTTGSELGPPRELTAVQTKATQIQLTWLPPYPEKAIVTAYRIRYSPRADDSNPTEVEL
SGDELTCSGYKSPIITSANLCATIKGLQPSTTYRFAVQGQSSSGNWGEWSSDYFSTTRND
DNELLGGSLKLLSAGHDNLKVKWTPPAVIGEKIDKYDLFISVASVLDQNPKKFDVSGHTT
DYHFRNLDSVTQYNVTVQGTSEGNKLWFISSVFSTTDFAEGLLSWLPAPTDLHLIEKSDT
MLHVDWVPPEIFDPEQRELITHHRVTIAPFDPTTGKTGPSKNYTVPYPGNSIKFEGLRPE
TIYNITVQAGTNSGYGHILWGTYSTLAPGQRHILRLLNRTPTTLNVAWEPVWGRAHSGYT
LTARTLYSVYGNVRLQQIKSFDVDASQTEFVIRGLHPSTVYNVTLTPKDHNEVAWGAYAT
LPPGWFVVKNLKQCDKTDFAVSMSWEPVELDMASDYQVRYLRVKEHDGIWTEEEARPAKE
LLCPKDGCGRLCYLVFNLPHNPSEYVFQVRAKVDGEWNHWKSAPKKMTSSEPLNVIVNLK
ISPNMNLFQIRRSCCIVPPPYFVDNIGAPGTFWEVDVNPAATENNVTRYYVVVDERDPPG
DTNWTELTDKVTANKMKIPYYVAASFNLETLPEPRKVRIGDGSVIGGYLNYPLVKGKKYN
YEVYTIWNVTGAPLVGRLRDVRGWDWLFNQIYFLWIFLPIICLLVLCCLIWMVYKYCKEL
VGRAWRSSPYITSSWPWWWLLLPLLAALLLTLLCCCIPWCLQRLILFPPFQTNLLYFRIS
FYVLKVPRHRSRKEHSRLVTNGQHAPLLEEQKAGMNENMRQLESRLDKMRGAVDGRARGD
FEDGYMKGYKDANKLGSANAARRRLDDEYGARDDRFHEGYVKGLKDAGMTGMTTSMHNLA
QRTGGGYSAGFAQGYKDGNSGIFGDRVTPSLVSRLDEQYAGQEDFKQGYVDGFKEGASSR
VGDRSRFEDSRRLQQSLTELTERLTSLEKTKGDEIHSTKIYHVYNQQPEGATMTSTGAQL
AQELEEIGSTSRRSTLRRHYTPGDYLKQDAEEGYNSLSRNRRSLSASALAANREAAHQSS
SYLQTGGTLSRSRHHMSHAGSSYLSRAAQDAQIGTDTYAKRYNYRSRSDVGSPRRYASQT
LLDGSRPGPSTPYARRDALHTLTKELDSLSRSPDVRGATPRGTTSAGYGSDTNAYDTVRS
RARGYSNYDYDTFQSSRNVTQTQATSGATQTSGATAAGAASSSSATQQDKSGKWAEQLID
LVSEPLDTTIARINNYTSSSNDRGQGDVVEEKYYRSHKEEHSSR
Download sequence
Identical sequences A8X9R7
CBG09834 6238.CBG09834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]