SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG10838 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG10838
Domain Number 1 Region: 85-112
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000537
Family LDL receptor-like module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG10838   Protein: CBP08711   Gene: WBGene00032105
Sequence length 249
Comment CBP08711 WBGene00032105 status:Predicted UniProt:A8XC39
Sequence
MCRWFTLLSLQYLVYLISAFGQEERNSLIRPIHPRRHKRTEQVRRPVVPRAPFVMWKNDL
KCMTILERPGMACPKKNVDDPLEKTVCIEPYQLCDDMRDCPGAHDEEPHFCMFKKLEDAE
LRKLESEIILIIQNKEKQRPEFKDVIVKNDDATATTVPATPSTIQEPIREGIFRSSGLGK
ADKTPSWMLKQNAQEDMNKTVEESEEEEEEDEEEENEEQEEEEEAETKKIQHPRRRTTRH
LFAIRAIRL
Download sequence
Identical sequences A8XC39
CBG10838 XP_002644901.1.8413 6238.CBG10838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]