SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG10976 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG10976
Domain Number 1 Region: 52-91
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000111
Family LDL receptor-like module 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG10976   Protein: CBP22466   Gene: WBGene00032199
Sequence length 118
Comment CBP22466 WBGene00032199 locus:Cbr-hen-1 status:Predicted UniProt:A8XBZ2
Sequence
MNFRFIVFALCVSRAVAQSAFGHGSHRPLNDADEVAASRPICDTDRHGNKYMPCATPDLG
NGRNWPCIKITDLCNGRRDCPNGDDEDHLHCFYHKYRLEEFQKLRKMLDEIRGKRYVW
Download sequence
Identical sequences A8XBZ2
CBG10976 XP_002644994.1.8413 6238.CBG10976

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]