SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG11006 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG11006
Domain Number 1 Region: 25-238,269-396
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 1.47e-43
Family beta-Lactamase/D-ala carboxypeptidase 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG11006   Protein: CBP33072   Gene: WBGene00032217
Sequence length 411
Comment CBP33072 WBGene00032217 locus:Cbr-lact-1 status:Predicted UniProt:A8XC10
Sequence
MFIAMFDPDLQTKISIAEHNIGGTVQKKFEAVATVFSENFNNGLESAGASFTVYQNDKLL
INLFGGLRNVEKKQPWVEDTTSVIFSTTKSISAVILAYTLDKHQKGISYETKISDIWLNF
GKNGKKDITILDAALHRAGLAYTEEVLEREDITKPEKIAKFFEEATPMTNGSDVLYHALT
FGLLLDQIVRRVDEKQRGIAEILDEDFIKKYGIKNLSIGLKCETHNEKVAKLTELDDLEI
ERQGVLNPEALEKFMAGDNIHHQKLYSIFPWITTDDYNLVSNRLLPMPSNMGISNAEGLA
HFHSLVASKQMLSKEFYEKLEKPVLEHTYDHAIGYEESKGYGFQYTKNPKGQWIFGHSGF
GGQNVRVDLNNGLTMAYVSNGMKITDADMVEPWRNLVKEVYRVFFEQNDIK
Download sequence
Identical sequences A8XC10
CBG11006 6238.CBG11006

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]