SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG11064 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG11064
Domain Number 1 Region: 270-355
Classification Level Classification E-value
Superfamily Immunoglobulin 1.01e-17
Family I set domains 0.033
Further Details:      
 
Domain Number 2 Region: 1987-2052,2184-2247
Classification Level Classification E-value
Superfamily Immunoglobulin 3.76e-16
Family I set domains 0.027
Further Details:      
 
Domain Number 3 Region: 1223-1311
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000254
Family I set domains 0.037
Further Details:      
 
Domain Number 4 Region: 1411-1499
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000176
Family I set domains 0.028
Further Details:      
 
Domain Number 5 Region: 44-136
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000426
Family I set domains 0.011
Further Details:      
 
Domain Number 6 Region: 1693-1780
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000112
Family I set domains 0.032
Further Details:      
 
Domain Number 7 Region: 186-223
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000038
Family LDL receptor-like module 0.00073
Further Details:      
 
Domain Number 8 Region: 1132-1215
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000845
Family I set domains 0.029
Further Details:      
 
Domain Number 9 Region: 1593-1683
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000155
Family I set domains 0.047
Further Details:      
 
Domain Number 10 Region: 1760-1882
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000172
Family I set domains 0.042
Further Details:      
 
Domain Number 11 Region: 232-271
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 12 Region: 1492-1591
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000013
Family I set domains 0.052
Further Details:      
 
Domain Number 13 Region: 953-1002
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000184
Family Laminin-type module 0.0073
Further Details:      
 
Domain Number 14 Region: 1315-1405
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000918
Family V set domains (antibody variable domain-like) 0.027
Further Details:      
 
Domain Number 15 Region: 146-183
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000196
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 16 Region: 1009-1061
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000335
Family Laminin-type module 0.0097
Further Details:      
 
Domain Number 17 Region: 2048-2143
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000775
Family I set domains 0.044
Further Details:      
 
Domain Number 18 Region: 682-721
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000246
Family Laminin-type module 0.03
Further Details:      
 
Domain Number 19 Region: 1894-1967
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000278
Family I set domains 0.094
Further Details:      
 
Weak hits

Sequence:  CBG11064
Domain Number - Region: 1064-1109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000279
Family Laminin-type module 0.033
Further Details:      
 
Domain Number - Region: 393-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000586
Family Laminin-type module 0.02
Further Details:      
 
Domain Number - Region: 915-955
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00131
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 629-657
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00193
Family EGF-type module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG11064   Protein: CBP02700   Gene: WBGene00032251
Sequence length 2295
Comment CBP02700 WBGene00032251 locus:Cbr-unc-52 status:Partially_confirmed UniProt:A8XCB6
Sequence
RSSTVVVALLALLLAGNTDAARHRKYRQTYQDIDSSDETSDVQITVFPSEKEVRDGRDVS
FECRARTSDNSVYPTVRWARVGGPLPSSAHDSGGRLTINPVSLSDAGTYICVSDYNGQTV
EARATLNVVSYGPQEVSNSNVLRQSGQCMADEKACGNNECVKNDYVCDGEPDCRDRSDEA
NCPAMSRTCEPNEFKCNNNKCVQKMWLCDGDDDCGDNSDELNCNAKPSDNGCKPTEFQCH
DRRQCVPSSFHCDGTNDCHDGSDEVGCVQPTVVDPPQTNLQVPRGSTFSLTCKAVAVPEP
YINWRLNWGPVCEPPRCLQTSEGGYGTLTIHDAQPVDQGAYTCEAINVKGRVLATPDCIV
RVVDEQPRPQPPPTAPPQRATCDTRGAVSPYPNNYGSCDCKSQVTGPNCDQCKPGAFHLS
EKSPEGCLKCFCFGVSNDCRSSGYYRTKDRLMFAGDAEGVTMSDIEERSIDRNAPYSFFK
TGYLTFDGTTDGVTKYWRLPQRFLGDKVTAYGGKMEFEIEFAGQGSHSSEPMVVLKGNQN
ILVHRVRNQEHVLRSDSPVRITVETYETNYEQLNGAAATREDLLMVLADLDAFLIRATHV
AHQSSTSLGDVSWEIAVDRYTPDGLALEVEQCVCPPGYLGTSCEDCAPGYERSGHGPYLG
TCVPIQPRHQQCGPGALAPTAPAQGQCQCKASVIGPNCDRCAPNSFGLAPANPQGCIPCF
CSGVTQQCSASNYRRTSVSIDYARGDRDQLELTTSDSRQPFSPQTRAHVSGQAIEFRSFE
EARGQTLYWKLPEKFLGDKVTAYGGVLKYTFKFSGSGSTDQSADVILRGNDIALQYKHRE
PFHPDRENNVEIKIFETSWQRVDGQQATREHLLMTLADLDTLLIKSTYNDDCTDSQLISV
NFEYAEPYGQGLTAAEVEQCICPPGYVGTSCEDCAPGYSRTGGGLYLGLCEKCECNGHAS
QCDKEYGYCLDCQHNTEGDQCERCKPGFVGDARRGTPNDCQPEATRAPCHCNNHSPRGCD
SFGRCLLCEHNTEGTHCERCKKGYYGDATKGSPYDCTPCPCPGASDCYLDNEGQVACRIC
PAGLEGRLCNECAPGYTRSNKPAGRVCEPIGQVTNEDITFVQKPHEVLRVRIMEPKRQIA
HPGDRVHWICQVSGFTTEKIHVEWTKVGEVSLPSNAKAYDGYLVLEGVEREHAGQYRCTA
TTITQYATDDALLTVSKKISGRPPQPVIDPPHLVVNEGEPAAFRCWVPGIPDCQITWHRE
QLGGPLPHGVYQTGNALKIPQSQLHHAGRYICSAANQYGIGQSPPAVLEVKRPSIPPKVD
PVRQTVDRDQPARFKCWVPGNSNVQLRWSRPGGGALPSGVQEQQGILHIPRAGDQEVGQY
ICTATDPRDNIPLQSEPVQLNIRDPAPQPRAAPQIDPPNQTVNVNDPAQFRCWVPGQPRA
QLKWSRKDGRPLPNGILERDGFLRIDKSQLHDAGEYECTATEPDGSTQVSPPARLNVNQP
QAIQPQVDPPVQTVNEGEPSRIRCWVPGHPNIQLQFVKRGRRPLPVHARVSGGNLEIPRT
LKSDEDEYICIATDPNTNRPVESNPARVIVKSPIRPIVDPAEQTVPEGSPFRIRCYVPGH
PNVQLSFRRASGQLNEDADENNGLLAVQRAELSDEGDYICTARDPDTGAPIDSTPATVHV
TSAAAPPVVEAHQEPPTAVVEPRTWNGKPGERHQFRCITTGSPTPKITWTGPDGSPLPHD
VTPLEPNILDFSNGRSELNGEYTCTASNPIGEASDHGVVNIGPSLTVKTNPPGPKLIVTV
GEPLQVKCEAFGAPGDPEPEVEWLHDPGPERGDLPDDFKPVTISEQFIRHPNVGLGNAGV
YTCKGSSAHATATKNIYIEVVEPSRIATVSILGGSSQWFDQGEKAEMICTATGSSLVDRL
EWEKVDDQLPTDVEEHNEPGLLHFPSFKNSYAGEYRCNGYRNNEIIASAAVHVHSSNDAD
DEPKVEIEPPRVRVVSQGDNIVLKCSVQGAENGEHFKWALLRGGSLVRQLGTEPTLEIVK
ADPSNDFGVYRCNVEDNNGLVIGSAYTAVSVGQQDKSHAQIVKFDDKSDASFTCPIYSVP
GSKVEWTYDNGDLPSKAVPNGNKIEIKEFDDASAGTYVCKVSFDGNVVEGFVTAQMFVPD
TIIQVLLEVSSESPQIGDRAWFDCKVTGDPSAVISWTKEGNDDLPPNAQVTGGRLLFTDL
QQDNAGVYRCVAKTKAGPLQTRTVLNVGSGKRKRKHLGNRRGRRLRHRRRNAGVQGSGVQ
SRKTRTTTKLFGSWF
Download sequence
Identical sequences XP_002646632.1.8413 CBG11064 6238.CBG11064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]