SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG11065 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG11065
Domain Number 1 Region: 313-355
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 2 Region: 123-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000262
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 3 Region: 414-452
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 4 Region: 562-601
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000641
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 5 Region: 273-309
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000694
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 6 Region: 713-748
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 7 Region: 167-250
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000495
Family V set domains (antibody variable domain-like) 0.093
Further Details:      
 
Domain Number 8 Region: 495-535
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000118
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG11065   Protein: CBP17067   Gene: WBGene00032252
Sequence length 823
Comment CBP17067 WBGene00032252 status:Predicted UniProt:A8XCB7
Sequence
MAFSLFSVVSLTVIYRLTINFPELPYTAELKNLESEEFLVNSKHIAHEIQHLVKDLEGKH
TARVVDFKYHKIIGSLVYVDLYAEKESPRVSDVLLSAIKSGKIGNLTVSDEGFELHVVRD
SSTACAATEFTCLDKTCIPADQRCDGRRDCPDGSDEHKDHGKCKQHQPIIHQTEKIVFAQ
KHGSIHLSASIDNSVKDSQIAWSKDSVLLGVGSLTLAEDGRVTVYKKGDKHHLHIQNATD
SDDGTYKMIIQGMNVEADFEVRITSDHLAIESDECPSGERSCKSGHCLPVSQFCDRRVQC
PDGDDEENCSEVQCKSNEFRCESTNVCVPTVVVCDGWKDCHDGSDEKTCSHPRKTYKPHH
NHVKVNAMCQDGSEPEFSLHGSSYCWSNKVCPSLTECVHGLCCPISKTRKRQSECLEGQF
KCNTGQCIEDSQKCNRKYDCADGSDETTCDYYLAVQKYHEQQERQDSQPAPTHAPSHHQQ
PPPPASTEEQSDNLVCNDQEFRCPYLAQTRCFHYDKLCDGVDDCGDGSDETNCDSNEDQD
QPAAPIPPPAPAPASAEKMSGRCSERQFECKRDGKCIDKTLECNHKYDCEDGSDETECEY
FKAAMARRGESSTVSTTTEQQHHQQHHQQQHQGHHQHNQAQQHPAQPAQPSHDAHEEHRR
RLEEHHRREEEHRRRQEEESRARAHQQSLLHASQVESTEVTFHDEYDGDSGVGCLEHEFQ
CAIGECIDKRRVCDTRPDCLDASDEQNCSDRAQPSQPDHHQQHHVAQPPPSLPSAPVNNY
PGQFATLNFCSFLSGGNHEKCALNAGGISKIQKNPKFKASGTF
Download sequence
Identical sequences A8XCB7
XP_002646633.1.8413 CBG11065 6238.CBG11065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]