SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG11153 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG11153
Domain Number 1 Region: 481-752
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-48
Family YWTD domain 0.00000183
Further Details:      
 
Domain Number 2 Region: 32-71
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000034
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 3 Region: 90-136
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000838
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 4 Region: 204-242
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000746
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 5 Region: 426-461
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000293
Family EGF-type module 0.0052
Further Details:      
 
Domain Number 6 Region: 292-337
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000929
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 7 Region: 251-285
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000102
Family LDL receptor-like module 0.0014
Further Details:      
 
Weak hits

Sequence:  CBG11153
Domain Number - Region: 391-433
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0709
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG11153   Protein: CBP35251   Gene: WBGene00032323
Sequence length 904
Comment CBP35251 WBGene00032323 status:Partially_confirmed UniProt:A8XCK6
Sequence
MRSRLALTGFVFISLVTILDGVVVRLGEPTKACKADSFKCEDNRCIPMSWRCDGDIDCQN
EEDEKNCPSKKIFFHSIYYQTENFQKLVFQCKNVSCHENQFQCEELTGDYSLCIPKTWVC
DGQRDCTNGKDELNCTAKAQKCPDNNFQYVVFHFNLSRCVDLIIPLRKIKKMSVPGATTV
TASSKTGCLLTGPSHCNASVNQCPPGEMWKVRSSCGSGECIPLRWKCDSEVDCKDHSDER
NCSSVQHTCKLAEEFACKTVNKCISKSFVCDGEFDCSDGTDEDDCDDQRKECKKGEWTCP
ATFGAYGAESGLVLCIPETLRCNGEEDCPDGGDEKNCSAEKPETCKEGTEFTCPSTPLQC
LEMTKLCTNSRFDCGDGNMSVCDQQKLIGLCKAGSDGCICRKSYVKGNDVCHCKEGYKLG
NGQCIDIVECETPGVCDQICLNTPGSYRCACHAGYQLSYGDSSSGSRRVANRCRAMGGDP
LVLLTNRQSIRQFDLVNKMYFPVSLKPGSAVAMDFHIKNGTLIWSDVIKKQILSCTIGNV
TDSYLGTEMCDKKHEVILDGEKIHTPDGLAVDWIHDLLFWTDGGLDQINVLDMKTRKQRV
LFSNDLEEPRAIAVDPEVGLIFWTDWGKNARIERSGMDGQNRVVIADGHRVIWPNGLALD
YVDKRVYWADAKIKSIFSCDYWGKDVKTVLHSHQFLRHPFSMAVFENRLFYTDWEHDGVI
TVNKFTGNDLQTVMTEVKSPMTVRIYHQQAQPHIEDKCFESACEHLCLPRAVYKEASRGA
EKAFNDRPFSCACEGTSASAALECFADLESKSGFSMFTIFLLLCVGGFVAAGFVMVRRKM
GARSFTALNFDNPIYRRTTEEGDHQMEDPFRDPFAEPANRSSRNDGLPTLASADNETRAD
ALSF
Download sequence
Identical sequences A8XCK6
CBG11153 6238.CBG11153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]