SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG11320 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG11320
Domain Number 1 Region: 1908-2195
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.99e-53
Family Protein kinases, catalytic subunit 0.00000896
Further Details:      
 
Domain Number 2 Region: 1426-1601
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000417
Family Fibronectin type III 0.0072
Further Details:      
 
Domain Number 3 Region: 1627-1831
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000604
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 4 Region: 372-569
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000131
Family YWTD domain 0.0057
Further Details:      
 
Domain Number 5 Region: 657-722,1038-1105
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000387
Family Fibronectin type III 0.009
Further Details:      
 
Weak hits

Sequence:  CBG11320
Domain Number - Region: 768-928,1193-1315
Classification Level Classification E-value
Superfamily Tricorn protease domain 2 0.000968
Family Tricorn protease domain 2 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG11320   Protein: CBP37602   Gene: WBGene00032454
Sequence length 2439
Comment CBP37602 WBGene00032454 locus:Cbr-rol-3 status:Predicted UniProt:Q61G93
Sequence
MLDFPRFSLFLFLLFSSFLFSSFVHAATVFSSSLKTCQSQCEERNLAYPLDSGEVHWTGL
AEFNYTTRISSCKHGCEDVDERESKCNVKCAEEGIVTNSCKQGCRAVLVSFLAQAQALLI
QTRVNMEVLETAMKLKWEFPETLAEELKEIANADIFWFSQTRPLNGILGWRWTSLPQSSF
RNSSLVSEVHVPFEHGEHVEVRLALSYRNQVLVSRTTTYHLPLSKAGTTLEVIGQLQLSD
DRVAVCYRTNQPTPKFKLTVMTMDDNTINTEESISRCHLFSNLPRDNCCKASISAIDEHG
ATTAFVEIKLDFFVNQVEIELVSAASSSRIIFSNGTHLLENEELAQYALGDSATVIPFPL
PTDDTITAIAGITDTIIAIGSSKGSLWTFQMSANQTDEDQPSSVIQLKTVGEMDTKITQI
EIDHIQRTLYAVQHDKGILRCKLRTMESEESPTCVLIVNNDALNPPKEITLDPVNGHIYS
LNVDNKVYRTEMIAFNATGIETVASLQYLKDMSPSNGIFFDVSKFLLYSALQNGSMMTLN
PVTDQAHIFKDSGYTDVQNFRIKSDLIYWMKKKCGKTDADENCIFTENLQRSEEDIPNKF
TYSSALMSYSFLEEILLKPRIVAVSSIALLTSDKTGRVSWDEANTLPFQAQGSSWRNFTY
FLKITAPDITDFEAVEMYTSSTDVKIDVTPGNQYNAQVQVCSDDFCSTPSSTSNTALPDL
GGGVPFVFTKKKADDIISIDMLGNLVITDDSVKAVERMQNPHVLDNTTKTVYLAGDHSMG
IFKKDLDDATGSPKPFKDGLFVEMMSIMPSRSMILIASSYKITSYRLPTTFDFEYYSCEE
PLEDCAEVMGISSDDSTGMVYFLTQSRNGTVILWESDPENRAPRDIATAPSIVPFRRFLI
IHDKMILVTKNNHIVQTDKSLKVVNVATELERVDRILPLRYAAISHKIEFTDEIKFMEGS
KTDLQWTLSPPLEAGTVIFKVSFFREKMGGQDAPITTIQSDTNFTIPPEVLKEWSSAQRF
DVSIQAITPWATAVLNRTGLTAPVKPPTPPTQLKIFATQQKTVDGPRALISFFWGPPLEW
NGTPYQYIVNCTKDDGKVITIDSSELKPLVKLFAIDSTNSLIIINDLAHEEPRRETRQVT
QPVKLDYQAMAFIGEDLYTVRKEGESAQPFLVQIDTNHIDNTVHKVSIGGDVTRIDAMTS
DWVGNRLIFVAGTNLYQLSLEPFLSTSLLNPHKLITLSAATDAKQLAYDPFMNTAYLLTK
NGSLFALDMNKNTEANLALTVPCLASQTVTWMMTEFAWNRASSPKIYALTWNGLINVDLA
EDFQCNEVRIDWSKFGEKGLKAISSFAIADKLFAFVTSSEMLIYGRDTVTPITIANPPLK
QILAVSQSSQPYPERSCFELPSSKGIVFSIVNEGKTGALLEVTKSSSSSACLDVSMPQTQ
YEIYFTRKNTDKVKHVRSFSDRIHVENGILDKETDYDVTVTWLNRYSPASGVSSSRSFRT
GFGYPSAPRDPHAIPVTPDTVYLYWSLPETLNAPISEIKYKISQQAAGISVPTSIAVIPL
SETVSSNISSDTTACLINPCRVKIANLRPSNEYKFWVTATHISHLDAATILKDDDAVSSE
AVARTLDVPGTLRPDNVTGSSLLLRWNGLEPEHRPTSIAIQYRESGGANNEWQSPTNASF
EPDVATELVPVTNLLSATTYDYRFVATYTGTYTIDGKVLAFKEDYLQLIQQARTKAGVPT
APQSVEAKIDTEGWIVTWKEPMSDGGSPITSYAVETRINKTAEWEIAERGLDGWKTWWRP
GKSETSSSMSYSSEVSEFRIRAANIEGFGAYAYTEEKKEEKEEEKGGILPYFLGISIILL
LAAMILVGCFWLKSRRRQQMKKREAEDERNCIRLDVVANMNFTNSRQTLSPEYESEIRNL
PIVDYNDVEIVRHISDCSYGSVHEGIAEEVPLSWEKQVKVAVKQLRPKSANHDFDRMMFM
KEAILLNNLDHNIVKELGVCVSPGQGLILLEYMEGGNLLNFLRESAPSEMQASELSTRDL
LAISVDIARGMNYLERLPHVHKNLSARKCLLSGRPGVAKLEMGMPRALSKGEINRVDLES
MQSVKWMAPEVFKDLMFTSKSDVWAYGVLLYEIFSFGEEPYGSMDSRRVITDVRDGNLTL
PVPPYCPSKKICKVMKMCLISDPNKRASFATILKIFETCRDDQQSQDDKRIHFNEGSDNI
NFNASQDSTSSREPPSPSHRIREFTQISGDLEPPSPSPLNQSFGGFEHPYEGDRPATMWN
ASGARNSAKNSIGRSMKKDKFRNPIHSMDDLVARSQRPLSIHSEDTESTDFGGATSSMHS
PSSSNRTNHYELPMSRLSAAPPIGIVNNAFESSNNSLNMSRSWTGLAGEVNPNPAGASSS
GTLPHHANSMVHLRAPTGQPPTRVNRNSSGGTCRSVSQV
Download sequence
Identical sequences Q61G93
CBG11320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]