SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG11546 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG11546
Domain Number 1 Region: 36-184
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000755
Family Fibronectin type III 0.0062
Further Details:      
 
Weak hits

Sequence:  CBG11546
Domain Number - Region: 223-285
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0311
Family Rhodopsin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG11546   Protein: CBP17218   Gene: WBGene00032651
Sequence length 330
Comment CBP17218 WBGene00032651 status:Predicted UniProt:A8XDG4
Sequence
MAARSYRLDSNGPEKRIYRSILDSTSCPRSSGHHFVITQHLVKVYDLSGNMSTNKRSISV
PIPLTRLQIDGLKPATAYNVTVQAGTSYGYGNKVWCAYATLDTDEANILKLRARTPNSLT
VYWPANWLTKATSKFTIKAKTIHSPTGIFKEIENSAIGEPGKAHEFVVDNLLPSSTYNIT
ITTIGDGKVYGGYVNYPLRSEKDPRWTLIPVTQSENEMIEPHLKTCGFNEQGSFNCDMTL
SEVLTHIPIVLVSAGFLILILVIFFICLAIFCFLRNSCQEKPGVEESALMYYRSDSPNTI
STCREYRKIERREFNASDMEERMRFRDHEN
Download sequence
Identical sequences A8XDG4
6238.CBG11546 CBG11546 XP_002637683.1.8413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]