SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG11882 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG11882
Domain Number 1 Region: 1521-1778
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-48
Family YWTD domain 0.00000833
Further Details:      
 
Domain Number 2 Region: 3360-3626
Classification Level Classification E-value
Superfamily YWTD domain 3.66e-44
Family YWTD domain 0.00000894
Further Details:      
 
Domain Number 3 Region: 404-683
Classification Level Classification E-value
Superfamily YWTD domain 5.36e-36
Family YWTD domain 0.0000399
Further Details:      
 
Domain Number 4 Region: 787-991
Classification Level Classification E-value
Superfamily YWTD domain 1.44e-29
Family YWTD domain 0.0012
Further Details:      
 
Domain Number 5 Region: 2172-2408
Classification Level Classification E-value
Superfamily YWTD domain 9.68e-29
Family YWTD domain 0.00013
Further Details:      
 
Domain Number 6 Region: 4265-4535
Classification Level Classification E-value
Superfamily YWTD domain 5.23e-28
Family YWTD domain 0.00035
Further Details:      
 
Domain Number 7 Region: 2514-2754
Classification Level Classification E-value
Superfamily YWTD domain 3.01e-27
Family YWTD domain 0.00019
Further Details:      
 
Domain Number 8 Region: 1868-2094
Classification Level Classification E-value
Superfamily YWTD domain 4.05e-27
Family YWTD domain 0.00045
Further Details:      
 
Domain Number 9 Region: 4102-4117,4167-4242,4540-4621
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000091
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 10 Region: 1427-1510,1781-1825
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000345
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 11 Region: 1209-1249
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000681
Family LDL receptor-like module 0.00071
Further Details:      
 
Domain Number 12 Region: 1080-1115
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00083
Further Details:      
 
Domain Number 13 Region: 3179-3220
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000209
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 14 Region: 1337-1371
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000301
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 15 Region: 4002-4041
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000615
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 16 Region: 3000-3042
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.00064
Further Details:      
 
Domain Number 17 Region: 3921-3959
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 18 Region: 3145-3179
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 19 Region: 1295-1330
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.0009
Further Details:      
 
Domain Number 20 Region: 54-93
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.00086
Further Details:      
 
Domain Number 21 Region: 3797-3832
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 22 Region: 224-264
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000406
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 23 Region: 1170-1207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.00072
Further Details:      
 
Domain Number 24 Region: 1247-1289
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000053
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 25 Region: 3710-3751
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000707
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 26 Region: 2873-2915
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 27 Region: 186-223
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.0012
Further Details:      
 
Domain Number 28 Region: 3230-3267
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 29 Region: 3754-3792
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000275
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 30 Region: 3672-3708
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000275
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 31 Region: 4095-4133
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000275
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 32 Region: 1788-1824,2129-2165,2438-2485
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000502
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 33 Region: 267-304
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000772
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 34 Region: 3305-3353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000001
Family EGF-type module 0.01
Further Details:      
 
Domain Number 35 Region: 3954-3997
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 36 Region: 3053-3086
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000144
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 37 Region: 2841-2885
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 38 Region: 3877-3917
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000249
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 39 Region: 2918-2957
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000825
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 40 Region: 3838-3874
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 41 Region: 1383-1418
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.0036
Further Details:      
 
Domain Number 42 Region: 1126-1161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000445
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 43 Region: 97-139
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000812
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 44 Region: 3091-3139
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000131
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 45 Region: 2964-3002
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000157
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 46 Region: 3630-3670
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000251
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  CBG11882
Domain Number - Region: 3278-3318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000307
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 313-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000315
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 4045-4085
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00126
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number - Region: 345-374
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00718
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG11882   Protein: CBP30549   Gene: WBGene00032921
Sequence length 4829
Comment CBP30549 WBGene00032921 locus:Cbr-lrp-1 status:Predicted UniProt:A8XE81
Sequence
MILRFLIFTALAVTTANSSTRQQAAAASSAFHSIQVDSPPSVRSRIISASVNTASSVCNE
NDFRCSDGKCIRAEWKCDGSGDCSDGEDEKDCPHPGCKSDQWQCDTYTWHSVSCIAEYQR
CDNITDCADGSDEKDCRELWTSGHTDNLSFKLLPLSTAALRTFSCVPMVVNALISPKNKD
SCSRNHTACFQYQFRCADKTQCIQKSWVCDGSKDCADGSDEPETCEFKKCTANEFQCKNK
RCQPRKFRCDYYDDCGDNSDEEECGEYRCPPGKWNCPGTGHCIEQLKLCDGSKDCADGAD
EQQCSQNLCPSLGCQAGCHPSPHGGECTCPSGYKLDDRFHRTCSDINECAEFGYCDQLCA
NHRPGFTCSCLGDCFTLQMDHGPGKDNLTMRGYCISNNADKMKLFVARREGLYRLNPKNP
DEEVKKLASGEFIYGIDFDYGDRKIFWTDRLAHSAFSADVDDEGEISQIKKLSLKSLVYP
RCLAVDWITNTLYIIESGSRRIDVSSYDGDRRTVLLADGLTLPLDIALDPLRGEMFFTNQ
LKIEAAAMDGTNRRTLVNTHTHQVSGIVVDITAKRVYWVDPKVDRLESIDYQVRKLLVDF
EFPPPKHFFLQGNDRRIVAQGMNTVPHPFGLALFDQYLYWTDWTRLGVVQVEKFGSDTKL
LWSNTENNVFPMGISAYHPMAQPGPGQSECLAMKIENPCTNADCEGMCILSKDNGGFGVG
YKCACPIGQKLVNGKRCIDSIDYLLFSSNKIVRGIFPEIAEKALAEAVLPISPISQRRIG
MYFEVECDVHGNSFFYADIMDNTIYRIRPDGEGSAPVLVTHNDGLFSMSFDWISKQLYYV
DNIRNSLEVVKIGETGLVQPDELVRRQLLTELRDPVSVVVHPWKGLLFYAEAMRPAAIYK
CHIDGTNCQVIRNTTLGRPSEMAIDFEEDRICWGDTLLKTISCMDLDGKNVNTLDTDTPI
PVAITILNEYIYYVHQRPYSIRRVHKKNGGGSKIVREFGADERSIFSLKACSHQNQPIPE
DSREHPCRASQCTQLCFATPSESDPNTLEAKCACREGFKINADNNHSCQRDKSESIEVLC
PNNSTQFLCKNGRCIPKEWKCDGENDCLDESDEVDEKGDKCFHETECAENTIKCRNTKKC
IPAQYGCDGDNDCGDYSDEDVKYCKEGQKPVCSAKKFQCDNHRCIPEQWKCDSDNDCGDG
SDEKIELCGNATCAANQFSCANGRCIPIYWLCDGDNDCYDGTDEDKERCPPVQCSALQFR
CANGRQCVPLRNHCDGQNDCEDGSDEDSCAVSSETCTSDQFQCVSSGLCIPASWKCDGQV
DCDDESDEPRFGCTRGRECKADQFKCGNGRCILNNWLCDGENDCGDGSDESAERGCKSPM
NTRKCPFEHVPCENDPETCIPLHQLCDGKRHCPGGTDEGGRCGRDLCSADRAGCAFKCHN
SPNGPICSCPQGEQCQFLKFLFQLVNKTKCEPENECLDASSCSQHCKDEKHGFTCSCEEG
YELDANKRTCKVQDNVKDTRIYVSNRNRIYYSDHKLDNWHTFGAVVENAIALAWDSLTDR
IYWSDIREKKILSANRNGTNATVFISDGLDITEGIALDWVGRNLYWVDSSLNTIEVANLE
DPKQRTLLVHQNISQPRGIAVDPRKGVMFWTDWGQNPCIERASMDGSDRQIIVKTKIYWP
NTIALDLTTNRVYFADSKLDFIDFVNYDGTGRTQVLASSKFVQHPHALAIFEDMMYYSDR
RLQKLQVYPKYPNGTTGEYPSHTFSKALGVVAVHPALQPVIKNNPCSNNPCSHLCLLNNK
NVGFTFTCKCPMGEKLDGSGKKCVDDAKPFLVIIQKTNVFGVEMDSSSESTWTRRSPTGT
PDLAGMVPLSGLGNAFDAAYDALSEEMFILEHTNHAKTLAQITTDSAIYRSTVNGGNKTK
MFSSAVPDDAYCLGFDWNGRNLVVGNKVTQTIELIRTQGKQYRSVILSNDQSPTAVVTPV
SIAVDADKGYVFWLDRGGGASDAKVARAGLDGSNPLVIASNDLAELDHIALDTTNQRVYF
SEAKAGRISSVTYDGQDRHYVLSDGGRQPNGLAFHGDRLFYADSAFDSIEVATILGDSQP
PSWTHFKKDVENLANIKVLQPRASSSSHPCHINNGNCDHICIPQMFAQHACSCANGFTKD
GQTSCKLFDESFVIVATKTKVTGYPIDESQSKGVAMEPIGGLSITGVDYDFESKTIYVAE
ASGINKGITAYTIGESAPRAVIRDSIGSLTIKSLAIDWINYNMYFINHDAERTNIEVSKL
DGTYRKILLTTKTETPSSIAVDPVARYLYWADQGQKPSIQRAFLDGSRREVIVSSGIGEP
TDLVVDVASRMIYWSDAKLDGIFRVRSTGGTPELVRSDIASAAGVALHGQNMYWTDNRLE
KLFRATSKPNQTSLLLSPTTVAASLKDIGDVAVFSSTNQPRASSPCQITDNLRKSPCTQL
CFATPGTQTPICACARGVLKGRTCEEPDTYLMFSDGDKIIDAAIEPDVKASRPLKEPFPE
ITNLQTFDVDVNLRRVYFVVESPIGVNISWFSMNNAENPRLVFGASKQAHAKEVRHISDM
KLDWLTQKIYFTTGRGGKVMVIDAAGEHLSTIASGDWTYALAIDPCSGLLFWSDSGYKTS
GGLYEPRIERSNLAGGSRKVIVSESISLPAAITVDFRNQMIYWADVNRLNIEVADYNGEN
RKIIASGYRAKSLDLWDRWLYMSDPLSNGVFRIDKESGSGLENVVSNRRIPGALRVFASE
SDVRTRNQVCNALTTQLCKNDNGGCDQLCSVIADDVGLAASKVQCSCNDTYELVQEPGKD
YPTQCVLRGSSSEPAKECLPPYNFQCGDGSCILLGATCDSKPDCPDASDENPNYCNTRAC
PDGYHLCTNRRCIDSAKKCNHIDDCGDGSDELDCPSAVSCAEGTFPCSNGHCINQTKVCD
GHNDCHDEQVSDESRATCPNLPIDCRGVKIRCPNTNICIQPADLCDGYDDCGDKADENQL
FCMNQQCAQHYVRCPSGRCIPETWQCDGDNDCSDGWDETHTNCTDTSGKKICVGDYLFQC
DNLKCISRAFICDGEDDCGDGSDEHARHGCGNRTCTDQEFHCASNAKLAQPKYECIPRAW
LCDGDVTCAGGEDESTDLCKTEKKECNKGEFRCNNQHCIHASWECDGDNDCLDGSDEHAN
CTYSSCQPDFWQCANHKCVPNSWRCDGNDDCEDGSDEKDCPKNSAAGQKTSKCSKSQFQC
TSGECIDDAKVCDRNFDCGDRSDESSLCFIDECSLAEKPLCEQKCIDQKIGYKCDCFEGF
AIDVSDQKSCHNVNECFEGISGCSQKCDDKIGSYKCACVDGYQLSSDDHSCKRVEMEPEP
FFLLANKHYIRKISMDGNKYELAAQGFDNVVSLDIDLTEKKAYLIDQGKLRLLRVNLDEM
DSPLSSYETVLRHNVYGTEGIAVDWVGRKLYMLNRQERSIRVCELDGRFCKTLIRDRIQQ
PKAIAIHPGKGYLFFTEWSLQPYIGRMALDGSPELPDPIFKLAEHDLGWPNAIAIDYFSD
RLFWGDAHLNEIGFMDFDGNGRRHIPAQRTSHVSSMVIFDDYLYWADWNLREVVRCDKWT
GKNETVLKKTVQLPNDLRIVHPMKQPAYPNPCGDNNGGCSHLCLIGAGGNGYTCSCPDQF
VLLPDQKTCEPNCTDRQFACGGDDAKCIPKLWYCDGEPDCRDGSDEPGESICGQRICPVG
EFQCTNHNCTRPFQICDGNDDCGDGTDEQNCDKACDPWMFKCAATGRCIPKRFTCDGDDD
CGDRSDEADSLCMSPDRNCTAEEFRCNNNKCIAKAWRCDNDDDCGDGSDETPECAQIECK
KGWTRCSSSYRCIPNWAFCNGQDDCRDNSDEDKQRCPTCDDVGEFRCATTGKCIPKRWMC
DTENDCGDNSDELDASCGGTTRPCSESEFRCNDGKCIPGSKVCDGTIQCSDGLDESQCTL
RRCTAGHRQCDDGTCIAEHKWCDRKKDCPNAADELHCEDVSRRTCSPFEFECANSVCIPR
KFMCDGDNDCGDNSDETSTECRMAQCDPPLRFRCAHSRLCLNILQLCNGMPDCGPNDFSD
EHLSMCSSFSEGSDCASDQFKCSNGKCVNATLACDRKDDCGDASDEIGCCKFFQTSQNFG
QFRNIPIFLSLEFRVEIATKHGGKTSCEAFGNNGGCKQICTDVRDGFYCHCRDGFRPDPQ
SPKECIDIDECAGNNTCTQLCLNTKGSYLCRCHEDYENNVVVGSMTGKDCRAKGDAANVM
IGADSSLVQLSLHGTGTNRHAAAKANDEDSDIIGIAFDPRKELMYWIDGSERTIYRSAIS
NGNQSHEGQKLDIDFAGMGVVPTAIAVDYTTGNLFVAAVSEDVENGLVTARKKRMSEPID
NQNTGFIFLALPDGRYVKKIVAGHLQQPTALITAPSAGRICYSDAGLHAKIECADMDGTH
RQIIVKDLVFSPTSMAIDEGKNNRIYWVDPKYRRVDAVNIDGTDRTTVVHDKHIPYAVDV
FENHIYWLSRESKTLYVQDKFGRGRVSVLASDLEDGHTVRVSQKYAKDTQRVVSGCERAQ
CSHLCVTLPSSGFACLCPEGIVPQMDGSCATQHVEALTMPKQCKCTNGGKCRLDGSCECT
SDFEGDLCDKESSVSRRIIGTLSENFFTVLLYILAFLAAFGLIGFIGLNVYKRRQLLFKK
NEAADGSVSFHGNVISFSNPVLESKQDAPGSEFSMQQMTSMHDDSTTFTNPVYDLEDVDM
SSPRSDNRPSTSSAMSPNGPSTSSASSSFVPPTFNQDEIEVKTSDQVIVPKVEISKPPIP
ARPNKKEKKEETLRVDNPLYDPDSEVSDV
Download sequence
Identical sequences A8XE81
6238.CBG11882 CBG11882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]