SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG12050 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG12050
Domain Number 1 Region: 3226-3484
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-42
Family YWTD domain 0.00000917
Further Details:      
 
Domain Number 2 Region: 1386-1652
Classification Level Classification E-value
Superfamily YWTD domain 7.98e-38
Family YWTD domain 0.00000557
Further Details:      
 
Domain Number 3 Region: 647-859
Classification Level Classification E-value
Superfamily YWTD domain 6.28e-36
Family YWTD domain 0.0000706
Further Details:      
 
Domain Number 4 Region: 2385-2625
Classification Level Classification E-value
Superfamily YWTD domain 3.4e-26
Family YWTD domain 0.00026
Further Details:      
 
Domain Number 5 Region: 4096-4278
Classification Level Classification E-value
Superfamily YWTD domain 1.31e-18
Family YWTD domain 0.00091
Further Details:      
 
Domain Number 6 Region: 344-519
Classification Level Classification E-value
Superfamily YWTD domain 1.18e-17
Family YWTD domain 0.0054
Further Details:      
 
Domain Number 7 Region: 1735-1932
Classification Level Classification E-value
Superfamily YWTD domain 8.37e-16
Family YWTD domain 0.0018
Further Details:      
 
Domain Number 8 Region: 2061-2260
Classification Level Classification E-value
Superfamily YWTD domain 0.0000000000000017
Family YWTD domain 0.0029
Further Details:      
 
Domain Number 9 Region: 3712-3748
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000183
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 10 Region: 1044-1082
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 11 Region: 1085-1121
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 12 Region: 1000-1040
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000497
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 13 Region: 3129-3215,3501-3551
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000989
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 14 Region: 2824-2858
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 15 Region: 2732-2776
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0021
Further Details:      
 
Domain Number 16 Region: 3620-3662
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 17 Region: 3046-3080
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000055
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 18 Region: 1175-1209
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000668
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 19 Region: 2877-2910
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000101
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 20 Region: 2914-2950
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 21 Region: 132-167
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 22 Region: 2960-2997
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000223
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 23 Region: 3938-3970
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000327
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 24 Region: 2774-2814
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000406
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 3575-3622
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000055
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 26 Region: 1260-1295
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000106
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 27 Region: 33-72
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000262
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 28 Region: 1303-1346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000263
Family EGF-type module 0.014
Further Details:      
 
Domain Number 29 Region: 963-994
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000288
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 30 Region: 82-115
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000301
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 31 Region: 1131-1161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000615
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 32 Region: 1213-1250
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000119
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 33 Region: 3662-3706
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000017
Family LDL receptor-like module 0.0018
Further Details:      
 
Weak hits

Sequence:  CBG12050
Domain Number - Region: 2697-2734
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000106
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number - Region: 4383-4419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000198
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 4545-4586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000262
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 4782-4821
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000371
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 3857-3889
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000746
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number - Region: 4627-4664
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000921
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 1342-1383
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00112
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 4741-4780
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00142
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 2633-2685
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00147
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 4704-4737
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00168
Family EGF-type module 0.02
Further Details:      
 
Domain Number - Region: 4667-4701
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00279
Family EGF-type module 0.01
Further Details:      
 
Domain Number - Region: 1661-1695,1980-2016
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00416
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 3801-3828
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00471
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number - Region: 3009-3042
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0103
Family LDL receptor-like module 0.0034
Further Details:      
 
Domain Number - Region: 235-272
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0167
Family EGF-type module 0.042
Further Details:      
 
Domain Number - Region: 3829-3848
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.017
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number - Region: 3756-3785
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0183
Family LDL receptor-like module 0.0026
Further Details:      
 
Domain Number - Region: 3901-3933
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0262
Family LDL receptor-like module 0.0032
Further Details:      
 
Domain Number - Region: 565-597
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0347
Family EGF-type module 0.031
Further Details:      
 
Domain Number - Region: 3093-3129
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0484
Family LDL receptor-like module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG12050   Protein: CBP27686   Gene: WBGene00033059
Sequence length 4940
Comment CBP27686 WBGene00033059 status:Predicted UniProt:A8XEF6
Sequence
MLSSRFLVILFVALLGVCLSDSPDSSLKKANTSSCVPPMRECDSGTPSGPKCYPEQWFCD
GYPDCRDNSDEPPTCKSKSFQKRACLENEFVCKTGKCLPRGYLCDGQLDCGRFPDGLQDR
SDESRELCNQPLNCEHNEYACAASAQCVPLFKFCDGKLDCSDGSDEVCRVKNISTANDCE
YGAAITIDGIKCYCPKNKFLNEKGKCEFVNQCDRLKNGIFNYLNRYILSILGLPPACSQG
CTDNKNGTFSCFCFDPRLTVANGTHCVAEKDVSIPSVAILTKQKIYTIQNGTMSNYSSLP
RPLGKPGALTLVFQHPDFPEAKVPILCLSEAPTSNQSYITCGNVEGSEPVTKSYAVDFDI
SAIHMIRFDNFGNNWIFTDASYYIFICKHDSVKISKCHTFAAGAMGTLQDVQYDGVNGQF
FVTDSDYFQQGIWRIDVASGERNRLTTQPITSPALAIDPFTKTLYYVDSSANSIKAIDYN
SNFSRIVVSGRIAKEVTQLDYAEGKLFATLRDNRVFVANALESDSEAVLKTWQEITPPSN
GGPNKVIMEVFHFRRNANAWKNKGRNICKAASCDDICIGHIEKTFSCLCRDGLIQKENKC
QEIDQNELKDKEILILAQLRPARVKVLGFNKDYQTEDIGIPDILAAKRPSAITFDPKGKR
ILMYDLKRHSLVVQKMDQSNTTFHGLTGIMNCEGMAYDYTSDNLYMTDQKRKLITVQRLS
NLSVQKIIVRGNMSNPRAIAVHVAKSYLFWGSWSEDRQNDATTPAMIERSKLDGSERKTL
VSKNSMWINGLTLDLKNDFLYWCDAYRNVIERIRWNGADREVIIQGVDKISHPYGLAFFD
NHIFFTEFKRGAVKRVNVNFPDQVQEIFQYSATVFELAVFKNSLSKCKLIHKTIFKTLIN
SATSPCSTSSSNCEHFCFATSCKGSVGCEPVKCGCADGMKLVDNGKCVKDEHWEDPNGCD
EDREFTCLNSRKCIPKANLCDGDDDCGDGSDEDSNGICKDFKCVGNKFQCDSTTCIPLEF
LCDGKSDCNDGTDELETMCKTVPDVRCSVGQFRCSNTKCIDKSKRCNGIQDCENGSDEED
CPRSKLCTPTEFRCGTGLCIKQSQVCDGKMQCLDGLDEKHCEENNSCIKGRQFRCANKQS
TCLDMIFQCDGVPDCEDESDESPEFCKGNTSSSCAKMNQFMCADGKCLRSFQLCDGFPDC
LTGEDEKECPPSMCNSATHLSCANGNKCVSKELECDGVDDCGDKSDESHCDDIRMEAALL
RCIPPMYKCQSGRFQCISDKQLCDGKNDCPSGDDEGMWCSFLCNSTEIGCSHTCRATPSG
PICSCPDEYFLEKDGVTCAKKDPCRFGQCSQHCMSQGSRHFCYCEDGYKLLNDRISCRTV
DPKTEFMIYSNRHEIRMIQATSPGSIPLISSLTNAIALDFKYLNNGSLIVYWTDLSSDKI
YSGLMDQRTIMYSRTIVSYGVFNAEGIAVDWITGNIYWIDSHLDTIQVLSEDGTKRATVV
NENMGNARSLAIDVEEGLMFWTDWEEANPRIERCTLAGKNRATVWKISNVAQAGWPNGIA
LDTITKRVYWVDAKSDSIHTITYDGRDHVLVLRDPERLGHCFGIDVYGDNVYFSDWRTNT
ISTVNKFGKGEVTIVERVATQPFSLKIVHRSKQKRQLKNMCDGFKCNGICLNDGRNKASC
QCTNIQTTTDDGCVDVEQTLLIATKNAVRGFSTIPPHPHAFPLVSGKQFENIRDVGSFQN
RLQILDDLTDQVVLVNLTGEADEQILATGSDMYGVSGMTIDPVLGNTYFTFFSNDGTGRI
EVINAEGTSKKVLVESGTFPGMRFPRGIIFVNSTKKLYWFEAGTTPYTIFTMSAAGNGAK
KLKLNSTLLTKVYNPTVDQFNSKLYWISQGKIVQFNPATEIINEIEVTGGDKNVSSIAVD
QKNGDILIGEFVRIANQTTVRRLSMKGTKSTQTGGVMQVPLHSSVQFFLATIDTSKVVKN
IPDECKTCESLCLSKDQKTFECACSQGYILENGKCRSPEKRVIYVTDDGSVQSVGWYKDQ
KSGEMVQVMRAHSLHSDIGKKRIVRLVADTKKDVIYVVTRQNEVWKCATNGSFAHMIYST
TSHRIAAISLDRVTGHLLVSARESVSSKGDIVLLDPDRYQEGMYSVIVEDEEKVPYEIAV
DPPKGKIFWASAHCIKAANYDGSEPKCIVAKSAVATIAVDEDRSRLCYMDSERAAVDCVD
YNGENEQRNVAMFKAQGLAEVVSLSFNGDEMFFFDKFNSSGSIVRGIVQKDGSVVFVDSI
KKQLPRQKLRIIDFDIMDQKKSVLFTACSNNNGGCEHLCITVPFEDSIKKKCICVHSVPT
EDGTCGQSNTFVAFTRFTSIEFLSATPGVMAPPYKQIASASCAMTKIGAIAADNSRGRIY
FADYEKFRISAVNFDGTGCVVIAEDVRVVPSMAYDEVNRELYYVSANPAGIWRIDVADNN
LENYPTEPKLVLLLTNRDRPRHLAIDPCRMLLFFTNNAITGSVIERAYFSGYKRKISEIF
KEQILQEDLHDLRGLAIDLETEKLYFSDSKDFRISRCDLDGCNREVVISNSDNPSIHPFE
LEIYENEIIFTDWVKRAVSGINKISGVEHRLMNRATEVPVGLVVVDVSKEFCTKNPCYEN
ELKCGDYCRLMADGQATCACNGERRLSADNKTCTGGNEIRYYWENSCYNFTDVDEKKCAE
NEFKCLHSDKCIPYEDTCDQYNDCPMFDDEDAKYCSSRVCRPGYFDCGNGLCISESKVCN
RFNDCINFHDENNCTCSKSEFKCDSGNCIPGEDRCNHVQDCNDASDEIGCPYRNCSSLVE
FGMSDLINCASTSQCIHPSWKCDGTNDCYDGSDELDCLVEFDFNKGSVSPPRSCDSATQF
PCLATRNCMPNRWRCDGQPDCADGSDEANCEQKACNSFEFTCESTKKCIPLEQKCDGRSD
CPNGEDENSCDTECDSKNGNSTFRCTNHRCIPMAWRCDGTDDCLDNAKSLGSDEMDCAPG
KTSFHVPSRCTDETCVVACELTAVLCDGIKDCNDGFDEENCASLDRQCKLNEWMCDSGQC
INSAHLCDSSVDCIDGSDEWVEICSLSEPPKRGCPNGWSCVLKNGTIGCLQEHQLCDGRK
DCMSGIDEQCDLPQGNCSSARNSCEQPWNCKRNAGFETCSCDEGFHLSPYDKRTCLRSPS
CPKANCSHFCIDRRDVGHQCFCAPGFILSDNQRDCRRNDTIEPEILMVSGHRLKLFTIDG
HAKATLLSNLTNGVALDYDVKSDLVYWTDVTNSGNKAGITSMSNQPYTYRIINSLPTKGI
DGIAVDWLGRHIYYTDRNHDAIAVCDMRGRFNRILLKGTPLNDPRAIVLDPIQALLFWTD
WGASAHIGRMNMDGSNEMIILEDRTIRWPNALAVDAPAQRLYFGDAHRDYIASCNYDGTK
RRMVLRNSVRHIFALAVFEDYIYWSDWHNHTIERVHKITGDNRKVLIQDKQYRPMGFKVV
HPSFQNMGSMKTAKHPCSQPARCDNLCIPASSPEAFTCMCAQGFRSDGRSCVSECKPNDF
VCTKTYKCIASWWRCDGQDDCGDGEDEGYFLKGVCPQFPCDPGQFLCPKSPRNTTAQCLY
ASKLCDGVKDCLEGEDEEKTFCEHFECTESQFKCGDKKKCIPLTSVCDKEKDCDDGSDER
SCEIKSCKPDFFACVNETTSQISKCIPKEFYCDGEDDCPNGQDEPDTCFGIGECTHEQFQ
CASGKCIPKRRKCDGTIDCRDGSDEKGCKKECAIVCDNECVPVEELCDGKRKCTHGTDEE
EEACAIKKLMEKPVLRTCGGFKCDGIIDCEDGADEKGCPDLECHLSNNASLICDGKVDCE
SGKDEQNCQNYGGYSNPLFQCSRQTVKEWQVCDGRWDCADGLDEYPEMCKSRQARCFRIG
FCDDKKQCLDVSTALCDGFKDCSDGSDESPAHCKDMCKGMFRCTNGRCLDESARCDGRDD
CGDGSDEDTCGLQCHHFGTCPQKCWMAYNSTARCHCDVGYTKSTKYNDCEPLTKFTEIFL
SNGKRLHLMVAEETRLRTVFNERMNIISGGIDFGYDMYKTTLMYSVGIGKNRVDIRTKKW
SESKPSDEWGEKNDESTAGLIAHDFMHNNVYLTESGSYIPGILFHTQENIYVAKSKDTNT
RTLIVNSTGSITSLSVDPIQRLIFWTTGAPVPRILSAHLDGTPIAQLFKTGSQPHKALIE
RNIFDPKSLILDSPNKRLYWIDGFKRTVETVSYDGRDRRTVRKFELGDSPVSMDIIGGYI
YLVTLQGNIHKMHKFSGKTNKYPQRIRDVAPRIRLLIAHPSKHTVSHITHQKNPCQSDYC
PSETVCIPKEDTNGVLIPKCLCGAGRFFEESTKKCLPVHDMNQEASREFFKILRDILNDF
FEKECGDYFCYNNAACSAQKKCICPPGFYGRQCEVSSNFRTIVINECSERCWNGETCAIR
ESGATRNIECHCPANYTQIDCATNVCEGVCGPRGSCKTVPCTREEPHCRSYSYCECDKGW
SGPHCRHKIDAKICYGHCFSGGECQGDQPSNLKCQCRPGFNGNRCQNCKDRECLNGGFCS
YFGSNRTMSHCICPSGYTGDNCEEYLCKDACSYGEKCVYDFTNHLQPISCFCEKNAAAPN
ADCSPICHKQPNWCHNGGKCLDMPGSPGKCKCLPRFTGPRCDVPVLCDDYCTNNSKCIET
NGTHFECECKPGFKGLRCEQETLCSECQNGAKCIKQPSRTVLCQCPEGLGGKYCEEITAV
SCNQLKCQNGGYCLEPDSDVDRNRPQCVCRPGFQGILCGSHSCDNFCHHDGKCSLNEEFE
PQCECYKAFTGDRCQYRVSHLTPPSEADSLSWTRFFVILIIVILTIVLLIGIVANRSNRF
AVFRQFRHNPLQNHEAPADQFSNPAYLIDEGGIELITQNTSLVSSHERGSFNNPAFEQEM
VPIYNDTVENHELLPNRSSN
Download sequence
Identical sequences A8XEF6
CBG12050 6238.CBG12050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]