SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG12069 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG12069
Domain Number 1 Region: 1263-1527
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.04e-46
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Domain Number 2 Region: 31-229
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.94e-43
Family Protein kinases, catalytic subunit 0.0000341
Further Details:      
 
Domain Number 3 Region: 1014-1112
Classification Level Classification E-value
Superfamily Immunoglobulin 5.41e-22
Family I set domains 0.039
Further Details:      
 
Domain Number 4 Region: 1092-1210
Classification Level Classification E-value
Superfamily Fibronectin type III 1.06e-16
Family Fibronectin type III 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG12069   Protein: CBP29250   Gene: WBGene00033077
Sequence length 1567
Comment CBP29250 WBGene00033077 status:Predicted UniProt:A8XEH4
Sequence
MVRFTINGANSTIDGLSSLTHPGVSISEPKGVNRETCVRVFVRQLLLALKHMHDLRIAHL
DLRPETILLQDDKLKLADFGQARRLLRGLITGEIKGSPEFVSPEIVRSYPLTLATDMWST
GVLTYVLLTGLSPFHGDNDNETLSNVDRCHFDSSPLGNFSYDAGDFVQKLLLEIPAHRLT
VDEALDHPWLNDEKLKNEPLSADTLREFKYQHKWLERRVFVQQTPSEQILEAILGPATAR
AQQNAPVAPEGRRPAEIYDYLRIQPKKPPPVVEYVPKPRKEHPPFIDEFGQLIDGEAFDE
GSGFEDHQRRPPPIPPQPQRPNQPSHDSRRFEQPGHPQRIPVENKYGRPIDPRYLNDPSH
RPSSLDDAPFYVDEYGNPIHLDEFGRPMAPQTLEKRKLIPQDKGETPSRSKKEKTGTPVS
TPILEPANNENQQQQQPQKVPIRMIRGERREIEEEIANRILSDISEEGSIAGSLASLEDF
EIPKDFQVEASEPSTPTLTPEVTIRETIPKPTPSPSTPQKSPVPPQEGTVIPPKVTYPDT
VLAGLPEADKKLVNRRSVLSCRKRIKSNLLDGKNGWDTGKKKERNEHCLTFFPTCVGGEI
HYFYRFYYFLYFFGKLILEKKVQNRFCRTYHQTNCKVSLNFFHSQPKYLFSVLFLVLFSR
YLCLKLFCYLLKPAEMNSLNELARPVSPSRPTTMHISPSLRTNGAIIAPGVKISCIDRKI
EQKLQNTILEDAENDPSIPVGAPLFLEGLHGADLTVDTTSASGLIKVTSPAVTLSPNPKS
PRRSTPGTKSPVMLSPRQEHSMEVLIATKRGKPGFLPPGELAEDIDDEDAFMDDRKKQVK
PKDHDGEDDFKDEKDRLEKDKNRRAVNLDDLDKFRPGAFYKEDNDFGHPGYDIDDSPWDS
HYQIGPDTYLMAARGAAFNSRVRNYREELFGVGAPTVKQGFLGVRNRDITVRERRRYTDI
LRESTQGLEPKSHEHSTALLQKAPSATAIERIKADIEKVTPSATKKNDDGTFAPIFTSRL
RDVYLRKNQSAIFECSVASSPAPKVTWDFQGKILESNDRIQIEQANNIARLIISNVAPYD
LGEYVCSATNEYGADKTSCRMISGETPSRPSRPEAELSSDTEIFLQWEAPEGPTYLEGIT
YRLEYRVAGPNDHGAPWITISEKIDDESVVVRHLSPFGIYQFRVTAQNGFGLGLPSLSSR
IVQTHGKGAPKLQIDVLKSEIRLNVVSMPQKSANQLGGISEESEEDSEARTTNDDMKSNL
QLQTSDPIGRFQIGGLKFKGRFSIIRDAVDSTTEGHAHCAVKIRHPSSDAISEYESLRDG
QHENVQRLIAAYNFNNFLYLFSERLYEDVFSRFVFNDYYTEEQVAMTMRQVTSALHFLHF
RGIAHLDVNPHNIMFQSKRSWIVKLIDFGRAQKVSSAVKPVDFDTKWASPEFHIPETPVT
VQSDMWGMGVVTFCLLAGFHPFTSEYDREEEIKDNVINVKCDPNLIPVNASQECLSFATW
ALKKSPVRRMRTDEALSHKFLSSDPSMVRRRESIKYSASRLRKLAAMTRQHQSTRPISDE
LESKYGN
Download sequence
Identical sequences A8XEH4
6238.CBG12069 CBG12069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]