SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG12070 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG12070
Domain Number 1 Region: 340-454
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-24
Family Pleckstrin-homology domain (PH domain) 0.000000681
Further Details:      
 
Domain Number 2 Region: 3879-3974
Classification Level Classification E-value
Superfamily Immunoglobulin 1.52e-24
Family I set domains 0.011
Further Details:      
 
Domain Number 3 Region: 3539-3630
Classification Level Classification E-value
Superfamily Immunoglobulin 2.94e-23
Family I set domains 0.015
Further Details:      
 
Domain Number 4 Region: 645-740
Classification Level Classification E-value
Superfamily Immunoglobulin 3.39e-23
Family I set domains 0.0017
Further Details:      
 
Domain Number 5 Region: 5553-5642
Classification Level Classification E-value
Superfamily Immunoglobulin 4.46e-23
Family I set domains 0.0096
Further Details:      
 
Domain Number 6 Region: 5342-5436
Classification Level Classification E-value
Superfamily Immunoglobulin 7.53e-23
Family I set domains 0.01
Further Details:      
 
Domain Number 7 Region: 5446-5537
Classification Level Classification E-value
Superfamily Immunoglobulin 1.95e-22
Family I set domains 0.0078
Further Details:      
 
Domain Number 8 Region: 3439-3534
Classification Level Classification E-value
Superfamily Immunoglobulin 3.08e-22
Family I set domains 0.0028
Further Details:      
 
Domain Number 9 Region: 3776-3867
Classification Level Classification E-value
Superfamily Immunoglobulin 4.75e-22
Family I set domains 0.022
Further Details:      
 
Domain Number 10 Region: 5032-5123
Classification Level Classification E-value
Superfamily Immunoglobulin 7.33e-22
Family I set domains 0.031
Further Details:      
 
Domain Number 11 Region: 6107-6200
Classification Level Classification E-value
Superfamily Immunoglobulin 7.61e-22
Family I set domains 0.0084
Further Details:      
 
Domain Number 12 Region: 5774-5868
Classification Level Classification E-value
Superfamily Immunoglobulin 1.08e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 13 Region: 145-326
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.14e-21
Family DBL homology domain (DH-domain) 0.0003
Further Details:      
 
Domain Number 14 Region: 3245-3337
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-21
Family I set domains 0.0071
Further Details:      
 
Domain Number 15 Region: 5660-5754
Classification Level Classification E-value
Superfamily Immunoglobulin 4.36e-21
Family I set domains 0.032
Further Details:      
 
Domain Number 16 Region: 747-843
Classification Level Classification E-value
Superfamily Immunoglobulin 4.37e-21
Family I set domains 0.004
Further Details:      
 
Domain Number 17 Region: 2846-2942
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-20
Family I set domains 0.011
Further Details:      
 
Domain Number 18 Region: 4643-4733
Classification Level Classification E-value
Superfamily Immunoglobulin 1.36e-20
Family I set domains 0.0055
Further Details:      
 
Domain Number 19 Region: 3977-4069
Classification Level Classification E-value
Superfamily Immunoglobulin 1.45e-20
Family I set domains 0.0082
Further Details:      
 
Domain Number 20 Region: 6466-6558
Classification Level Classification E-value
Superfamily Immunoglobulin 5.18e-20
Family I set domains 0.0051
Further Details:      
 
Domain Number 21 Region: 3343-3432
Classification Level Classification E-value
Superfamily Immunoglobulin 8.58e-20
Family I set domains 0.0042
Further Details:      
 
Domain Number 22 Region: 3645-3737
Classification Level Classification E-value
Superfamily Immunoglobulin 9.69e-20
Family I set domains 0.0032
Further Details:      
 
Domain Number 23 Region: 5232-5326
Classification Level Classification E-value
Superfamily Immunoglobulin 3.31e-19
Family I set domains 0.007
Further Details:      
 
Domain Number 24 Region: 1043-1139
Classification Level Classification E-value
Superfamily Immunoglobulin 4.64e-19
Family I set domains 0.006
Further Details:      
 
Domain Number 25 Region: 5883-5975
Classification Level Classification E-value
Superfamily Immunoglobulin 9.08e-19
Family I set domains 0.0039
Further Details:      
 
Domain Number 26 Region: 2619-2713
Classification Level Classification E-value
Superfamily Immunoglobulin 1.37e-18
Family I set domains 0.0059
Further Details:      
 
Domain Number 27 Region: 2953-3043
Classification Level Classification E-value
Superfamily Immunoglobulin 2.58e-18
Family I set domains 0.014
Further Details:      
 
Domain Number 28 Region: 5995-6093
Classification Level Classification E-value
Superfamily Immunoglobulin 3.6e-18
Family I set domains 0.0068
Further Details:      
 
Domain Number 29 Region: 2326-2417
Classification Level Classification E-value
Superfamily Immunoglobulin 1.37e-17
Family I set domains 0.013
Further Details:      
 
Domain Number 30 Region: 560-639
Classification Level Classification E-value
Superfamily Immunoglobulin 1.39e-17
Family I set domains 0.0044
Further Details:      
 
Domain Number 31 Region: 5127-5216
Classification Level Classification E-value
Superfamily Immunoglobulin 1.87e-17
Family I set domains 0.012
Further Details:      
 
Domain Number 32 Region: 6232-6329
Classification Level Classification E-value
Superfamily Fibronectin type III 3.3e-17
Family Fibronectin type III 0.00062
Further Details:      
 
Domain Number 33 Region: 4171-4265
Classification Level Classification E-value
Superfamily Immunoglobulin 4.2e-17
Family I set domains 0.012
Further Details:      
 
Domain Number 34 Region: 2034-2124
Classification Level Classification E-value
Superfamily Immunoglobulin 9.88e-17
Family I set domains 0.0096
Further Details:      
 
Domain Number 35 Region: 3148-3238
Classification Level Classification E-value
Superfamily Immunoglobulin 1.04e-16
Family I set domains 0.0077
Further Details:      
 
Domain Number 36 Region: 2711-2802
Classification Level Classification E-value
Superfamily Immunoglobulin 9.28e-16
Family I set domains 0.01
Further Details:      
 
Domain Number 37 Region: 4359-4449
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000147
Family I set domains 0.014
Further Details:      
 
Domain Number 38 Region: 945-1037
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000155
Family I set domains 0.0095
Further Details:      
 
Domain Number 39 Region: 2228-2320
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000168
Family I set domains 0.0089
Further Details:      
 
Domain Number 40 Region: 4261-4348
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000351
Family I set domains 0.014
Further Details:      
 
Domain Number 41 Region: 4547-4640
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000391
Family I set domains 0.012
Further Details:      
 
Domain Number 42 Region: 4832-4925
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000247
Family I set domains 0.01
Further Details:      
 
Domain Number 43 Region: 1941-2033
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000385
Family I set domains 0.0065
Further Details:      
 
Domain Number 44 Region: 6366-6469
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000131
Family I set domains 0.025
Further Details:      
 
Domain Number 45 Region: 2520-2613
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000161
Family I set domains 0.014
Further Details:      
 
Domain Number 46 Region: 2422-2514
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000163
Family I set domains 0.0054
Further Details:      
 
Domain Number 47 Region: 4452-4542
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000003
Family I set domains 0.0033
Further Details:      
 
Domain Number 48 Region: 4741-4825
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000481
Family I set domains 0.031
Further Details:      
 
Domain Number 49 Region: 4929-5020
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000599
Family I set domains 0.023
Further Details:      
 
Domain Number 50 Region: 4074-4162
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000717
Family I set domains 0.015
Further Details:      
 
Domain Number 51 Region: 2130-2224
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000174
Family I set domains 0.0083
Further Details:      
 
Domain Number 52 Region: 840-935
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000337
Family I set domains 0.0095
Further Details:      
 
Domain Number 53 Region: 3045-3142
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000782
Family I set domains 0.007
Further Details:      
 
Domain Number 54 Region: 1138-1238
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000129
Family I set domains 0.0081
Further Details:      
 
Domain Number 55 Region: 61-124
Classification Level Classification E-value
Superfamily SH3-domain 0.000000038
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 56 Region: 1844-1941
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000453
Family I set domains 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG12070   Protein: CBP02940   Gene: WBGene00033078
Sequence length 6561
Comment CBP02940 WBGene00033078 locus:Cbr-unc-89 status:Predicted UniProt:A8XEH5
Sequence
MASRRQKQFDRKYSSYRKFTATEDFNYSTHSSRSSYRSESVTSRTDGRGRSTSSEIIAGS
ESRSYPVYIAIQDYTPDKEDVEAIPLEQGQIVEVLDKKNSIRWLVRTKARPPRSGWVPGS
YFETPTEFYKQRRRTREIENVSLSDEQAALVKRDQVYHELLRSEEEFVSSLRTCVDDYIK
VLDDPGVPEAVKKHREELALNIPELYNFHANVMLKGLNYYSDDPGKVGQTFVRLEKDFES
HVEFYKQYADTLKLLEEPEIKRFFEGLSAKNDAGASSFVDHVKEIADRMVQYQNYFKEFV
KYSARAHGSSKSIQKALELVTTIPQRVIDLEFTSNLKQHPGDTGKLGRIIRHDAFQVWEG
DEAPKLRYVFLFRNKIMFTEQDASTSPPSYTHYSSIRLDKYNIRQHSTDEDTIVLQPQEP
GLPSFRIKPKDFETAEYVRKAWLKDIAEEQGKYAAERDAISMTATSEMTASSVDFDMNVS
DQQSEFSEWSGSRKSSLFPGPEEGGPPRKKVKSPPVISPTGSSTSIYSGGSSSIDWTTTG
TTLEMQGTRVTRTQYGFRTLQESSAKMCLKVTGYPLPDITWYKDDVQLHEDRHTFYSDED
GFFAMTIDPVQVTDTGRYTCMATNEYGQASTSAFFRVLKVEKEAAPPAFVTKLKDKECKE
GDVIDFECEVEGWPEPELVWLVDDQPLRPSHDFRLQYDGQTAKLEIRDAQPDDTGVYTVK
IQNEFGSIESKAELFVQADPDKNHVAPEFQAMIEDVECDEGEEVRFKSVITGDPNPEITW
FINGKPLSESEKVKFISEDGICILTIKDVTRHFDGMVTCQGSNRLGSASCDGRLKVRVPP
APPTFNKPLEDKTVQEKSTVVFEVDVSGWPEPTVKFTLCGKELKHGEESVEIVGHDGFYR
ISIPNTSIEKHDGEIVAKAQNEHGTAESRARLTVEQEEEESRSAPTFLKDIEDQTVKTGE
FAVFETTVRGNPNPEVTWFINGHKMDQGSPGVKIEAHNHDHKLTIDSAQYAGTVLCRAEN
AVGRFETKARLIVLAPEKQKKPPKFVEILVDKIETVDNTVVFEVRVEGEPKPTVTWYLKG
EELKQSDRVEIREFDGSIKLQIKNIKIEEAGEIKAVATNSEGFDETRATLKVQKKPFAPE
FDLRPRSLTVEKGSEAVFTAHAFGIPLPTYEWSINGRKVRDGQEGAHVTRDESTVDGASI
LTIDTATYYSEVNHLTISVVAENTLGAEETGAQLTIEPKKVVIQLTKPNNSRYYLNKLKA
KEASPEATTTITMETSLTSTKTTTMSTTEVTSTVGGVTVETKESESATTTGIIGGGSTEG
SISVSKIEVVSKTESQTDVREGTPKRRVSFAEEEPPKEVIDPERKKKKSPTPEKKGKSPE
MTSDEKPKSPTTEEKTPEKVEEKPKSPTKKEKSPEKSTTVEVKSPTKKEKSPEKPTSPTK
KNAEEAVKSPTKKEKSPEKSEEKVKSPTKKEKSPVRSEEVKSPTKKEKSPEAKNIVEVSS
ETTIKKTEATAEVTKTSEEAKSPTMKEKSPGKVEEKPKSPTKKEKSPEKPTSPTKKTEDQ
PGSPFPPKSPTKIEEKPSSPTQKKSPPASPKKAKSPEKFEEAVKSPTKKEKSPEKMADEK
PTSPTQKDKPPEQVEKKPTSQTKKEKSPEKSTTEEVKTPIKKEKSPEKSATEEVKSPTKK
EKSPEKPTSPTKKTAEEAVKSPTKKEKSPEKIEEKPKSPTKEEKSPEKSTGAEDVKSPIK
KERSPDTVVEKEITSSETTKTEKSSTTTTEVTSPIKKSPPGSPTKKQKKSKSPEAEKVMF
GRIVRDRFLKKKLEDFCEESVCVCVCVRERERERERERTDPPAPKLTRDLKSQTVNKTDL
AHFEVVVEHATEIKWFLDGKEITTAQGVTVSKDDQFEFRCSIDTTVFGSGVVSVVALNAS
GSVETKTDLKVLETPKETKKPEFTDKLRDMEVTKGDTVQMDVIALHSPEYKWYQNGNLLE
DGKNGITIKNEENKSSLIIPNAEDSGKITIEASNEVGTSESSATLTVNPPSTTPIVVDGP
KSVTIKETETAEFKATITGFPAPIVKWTINEKIVEESPTVTTIKTEDVYTLKISNAKIEQ
TGTVKVTAQNSAGQDTKQADLKVEPNVAAPKFKSQLTDRTVDEGEPLRWNLELDGPFQGT
EVTWLLNGQPLTKSDTVQVVDHGDGTYHVTIAEAKPDMSGTLTAKAKNAAGECESTAKVT
VNGANKKPEFIQAPQNHETNIEESVKFSAIVTGKPMPNVSWFLNDKKLIQSEEVKVKYVH
ETGKTSIRIHKPLMEHNGTIRVEAVNVAGKVEATAQLKVDRKTEVPKFTTNMDDRQVKEG
DNVKFTANVEGYPEPSVAWTLNGEPVAKHANITVTDKDGEHTIEIAAVTPEQAGELSCEA
TNAVGSKKRDVQLAVKKVGEAPTFAKNLEDRLVTEGELALMDAKLNAVKPKPKITWLKDG
VEIKSDDHYKLVEEEDGTLKLSILTTKLDDKGRITIKAESEFGLAETSASLGVVKGRPMA
KPAFQSDIAPINLTEGDTLECKLLITGDPTPFVKWYINGQLVCATEDTEISNANGVYTMK
IHGVTSDMTGKIKCVAYNKAGEASIEGPLKVVAPIPVEFETSLCDATCREGDTLKLKAVL
LGEPEPVVSWYVNGKKLEESQNIKIHSEKGTYTVTIKDITCDYSGQVVCEAINEYGKATS
EATLLVLPRGEPPDFLEWLSNVRARTGTKVVHKVVFTGDPKPSLTWYINNKEILNSDLYT
IVTDDKTSTLTINSFNPDIHVGEIICKAENDAGEVSCTANMITYTSDMFSESESEAQAEE
FVGDDLTEDESLREEMHRTPTPVMAPKFITKIKDTKAKKGHSAVFECVVPDTKGVCCKWL
KDGKEIELIARIRVQTRTGPEGHITQELILDNVTPEDAGKYTCVVENTAGKDTCEATLTV
IETLEKKTDNKAPEFIVALQDKTTKTSEKVVLECKVVGEPKPKVSWLHDNKTITQESIKI
ESVEGVERVTITSTELTHQGKYTCIAENSEGTSKTEAFLTIQGEAPVFTKELQNKELSIG
EKLILSCSVKGSPQPHVDFYSFSETTKVEKKITSSSRIAIEHDQANTHWRMVISQTTKED
IVSYKAVATNSIGTATSTSKVTTKVEAPVFEQGLKKTSVKEKEEIKMEVKVGGSAPDVEW
FKDDKPVSEDGNHEIKKNPETGVFTLVVKQAETTDAGKYTAKATNPAGTAESTAEAEVSK
SLEKPTFVKELVQTEVKINETATLSVTVKGVPEPSVEWLKDGQPVQTDSSHVIAKVEGFG
SYSITINNARTEDSGKYACRATNPAGEAKTEANFAVVKDLAPPEFVEKLSPVEVKEKESI
TLAVKVVGKPEPAVEWFKDDTPINIDNVHVIQKQTAVGSFSLTINDARQGDVGIYSCRAR
NEAGEALTTANFGIIRDSIPPEFTQKLRPLEVREQETLDLKVTVIGTPAPNVEWFKDDKP
INIDNAHIFAKDEGSGHHTLTIKQARGEDVGVYTCKATNEAGEAKTTANMAVQEEIEAPL
FVQGLKPYEVEQGKPVELEVRVEGKPEPEVKWFKDGAPIAIDNKHVIEKKGENGSHTLII
KDTNSADFGKYTCQATNKAGKDETIGELKVPKYSFEKQTAEEVKPLFIEPLKETFANEGD
TVVLECKVNKDSHPQIKFFKNDQPVEIGQHMQLEVLEDGNIKLTIQNAKKEDVGAYRCEA
VNVAGKADTKADLKIQFASKVEEHITDESGQLEEIGQLETVGETASSKTDTGRGAPEFVE
LLRSCTVTEKSQVVLKCKVKGEPRPKIKWTKEGKEVEMSARVRAEHKDDGTLTLTFDNAT
QADAGEYRCEAENEYGSAWTEGPIIVTLEGAPKIDGEAPDFLQPVKPAVVTVGETAVLEG
KVSGKPKPTVKWYKNGEELKPSDKIKIENLDDGTQKLSVPNAQLSDMDEYRCEASNEFGD
VWSDVTLTVKEPSHIAPGFFKDLSAIQVKETETAKFECKVSGTKPDVKWFKDGSELKEDK
RIHFESTEDGTQRLVIEESKTEDQGNYRIEVSNDAGVANSKAPLTVIPAEILKIKKGLND
VSVTQGSKILLSVEVEGKPKTVKWYKGSETVTSSSTTKITQVTESEYKLEIESGELSDSG
SYRVVLSTDSLYVESSATVTVSKAAEKISLPSFKKGLSDQSVPKGTPLVLEVEIEGKPKD
VKWYKNGDEIKAGKVEDLGNGKYRLTIPDFKETDVGEYSVTAANEAGEIESKAKVNVSSK
PEIVSGLVPTTVKQGETATFNVKVKGPVKGVKWYKNGKEIPDAKTKDNGDGSYSLEIPNA
QVDDGADYKVVVSNDAGDADSSAALTVKLAEDGKDKVKPEIVSGLVPTTVKQGDTATFNV
KAKGPVKQVKWYKNGKEIPDAKSKDNGDGSYSLEIPNAQLDDTADYKVVLSNDAGDADSS
AALTVKLPGIEIVKGLEDTEVPKGKKVVLEVETNKKPKEVKWYKNGKEITPNNKAEAGSD
GDKKSQLVIPDAGDDDAAEYKVVLTDDDGNTAESFCALTVKLPAEEPKIIKGLEDQVVPI
GSPIKLEIETSGSPKTVKWCKNGKELSGAAAKNIKISKIDDNKYILEIPSSVVEDTGDYK
VEVANEAGSANSNGKITVEPKITFMKPLKDQTITEGENAEFAVETNTKPRTVKWYKNGQE
IKPDSRFVIEQKSDTKYQLVIKNAVRDDAATYKVVMENTAGEADSSAQLTVKKAKAGLCK
IVKGLEDQVVAKGAKMVFEVKIQGEPEDVRWLRDANVISAGTNAIIEKMDDTTHRLTIPS
ADLKDAGEYTVEVINESGKAKSDAKGEVDEKPEIVRGLENIDIPEGDDDIFKVEVSAPVR
QVKWYKNGQEIKPNSHLEAKKIGPKKYELAINRAQLDDGADYKVVLSNAAGDCDSSAALT
VVKPNVLKIVDGLKDVDVEEPQPVELKVKVEGIPKVVKWYKNGQELKPDSDGFKFEEKPE
SGEFSLLIPSSKKSDGGAYRVVLGNDKGEVYSGSVVHVKAAKPADATSGANFLSPLKDTE
VEEGDMLTLQCTVAGEPFPEIIWEKDGVVLQKDDRITMRTALDGTVTLRIRSAKKSDIGQ
YRVTAKNEAGSASSDSKVTVTEQGEQPSKPKFVIPLRSGVALPGDKKEFNVKVRGLPKPT
LKWILNGKPITFDDRVTLDDMADGNYCLTIRDVREEDFGTLKCIATNENGTDETVCEFSQ
GQDHEGGMRDDLRYPPRFNVPLWDRRIPVGDPMFIECHVDANPTAEIQWFKDGKKIEYTA
HTEIRNTVDGACRIKISPFEESDIGVYMCVATNELGQAETQATYQVEILEHTEEEKKKEY
APRINPPLEDKTVNGGQSIRLSCKVDAVPRASVVWYKDGLPIRADSRISVQYEEDGTASL
AINESTEADIGAYRCVATNAHGTINTSCSVNVKVPKQEVKKEGEEPFFTKGLVDLWTDRG
ETFTLKCAVTGDPFPEIKWYRNGQLVRTGPRTIVENSPDGTCSLTVKESTMSDEGIYRCE
AENAHGKAKTQATAHVQMALGKTEKPKMDEGKPPKFILELSDMSVSLGNVIDLECKVTGL
PNPSVKWSKDGGPLIEDSRFEWSNEPAKGVYQLRIKNATVHDEGTYRCVATNENGSATTK
SFVRMDDGLGSGVVTASQPPRFTLKMGDVRTTEGQPLKLECKVDASPLPEMTWYKDGAIV
TPSDRIQISLSPDGIATLLIPSCVYDDDGIYRVIATNPSGTAQDKGTATVKKLPRDSGAR
RSAERDVFDANKAPKLMEPLENIRIPEKQAFRLRCKFSGDPKPTIKWFKDGERVFPYGRL
QLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSARTSCDVNVIRGDRKPRDIDSSIRE
GKAPGFTIPLTIRRAKPGESVTFECLPFGNPFPAIKWLKDGLELFADEKIKMEAAADGTQ
RLIISDVTFLSEGYFRCVATNEHGTASTKAELVIEGDRTIGSRSLPEGNGEPEECKPRIR
RGLYNMSIHEGNVVEMIVCATGIPTPTVKWYKDGKEIIGDGPDGKRVIFTDERGIHHLVI
VNASPEDEGDYSLEATNKLGSARTEGSLNIIRPRHVADADDRGGMPFPPGFVRQLKNKHV
FNHMPTIFDCLVVGHPAPEVEWFHNGKKIVPGGRIKIQFCGGGSHALIILDTTLEDAGEY
VATAKNSHGSASSSAVLDVTVPFLDNIKFNGEIDVTPYLTEEYGFKKLNTASLPTPPDRG
PFIKEVTGHYLTLSWIPTKRAPPRYPQVTYVIEIRELPEKEWTLLDYNIPEPVCKVRNLE
LGKSYQFRVRAENIYGISDPSPASPPSRLMAPPQPVFDKRTNKVIPLLDPYAERALDLKY
SEQYACAPWFAPGVVEKRYCAENDTLTLILNVSGFPDPDIKWKFRGWDIDTSSPTSKCKV
YTYGGTETTLAITGFSKENVGQYQCFAKNEYGDAQQNILVDLATRPNFIQPLVNKTFSSA
QPMRLDVRVEGEPFPELKWMKEWRPIVESSRIKFVQDGPFLCSLIINDPMWRDSGIYSCV
AINDAGQATTSCTVTVEGRFD
Download sequence
Identical sequences A8XEH5
CBG12070 XP_002646356.1.8413 6238.CBG12070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]