SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG12078 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG12078
Domain Number 1 Region: 140-329
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.36e-44
Family DBL homology domain (DH-domain) 0.0000217
Further Details:      
 
Domain Number 2 Region: 337-458
Classification Level Classification E-value
Superfamily PH domain-like 2.22e-26
Family Pleckstrin-homology domain (PH domain) 0.0016
Further Details:      
 
Domain Number 3 Region: 647-752
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000102
Family I set domains 0.021
Further Details:      
 
Weak hits

Sequence:  CBG12078
Domain Number - Region: 758-804
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0106
Family Fibronectin type III 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG12078   Protein: CBP25032   Gene: WBGene00033083
Sequence length 812
Comment CBP25032 WBGene00033083 status:Predicted UniProt:A8XEI0
Sequence
MNSITIIRRIFANSSKERSSSSNNNSPATRQSTSTSSPLAANGHTAESSSIGVLSSGELS
TAGNSNSTPSSSTPTHGPTSSSPTVIPVVVAEDEKAEDCLPPPMENITITNNSMEEKDVN
DDPMAVSDVAEPEVPEKVEKTPEETARFKRSYVLMELVETEQDYVKDLTSVVEGYIGNLE
KMDLPADLVGKDKIIFANIAQILDFHKTCFLKEIEKCTENYEAAGQAFVKYERRLHTLYV
KYCQNKPKSDYLLAQDDFEGFFADTKAKLGHKVALCDLLIKPVQRIMKYQLLLKDILKFT
ERAKDRPDVLKKALGVMHVVPKACDDMMQVGRLQNFDGNLGAQGRLIHQGTLQISESVAG
NTQKPKDRRIFLFEQSAIIADHIPPKKEFGNPTYIFKNQIMVNKMVFEPQVADDPLRFVI
KSSDPTQPTSFIANAQTQEEKDEWNRKISEQLDQQKRLLAALVDPKRFMGGSDDMSGGMG
NMSLGPSGNDKKASSSTAKSSATTSKKAAESPKKESKSKSLFSFGKKPAKSPTSPPPLEA
AGNGRFIKITDDQVNLETDEKVQVFDVKNGYANVKKSDGTIGKCPNYFLTMSEIPGENFA
EQIQYRREWQRRVDEADVKYGPSAFDVATSSTENFDVLLELSTCERPVVVEEMKDLEVVE
GDDVEMTPIISSHTDYTVVWYGPAVDTKRAKIQVAKGLHNGTKTTNIQTNNLDSRLLIRK
VKKCDAGAYSVIAKNSFGVTSSVSFLTVISVPDGSSPENWQIASTNIEKAHVSLRNFARH
SYSFRIFAYNQRVRSTPSSSISVVFDGNSNKQ
Download sequence
Identical sequences A8XEI0
6238.CBG12078 XP_002646363.1.8413 CBG12078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]