SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG12386 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG12386
Domain Number 1 Region: 2541-2653,2688-2710
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000103
Family Growth factor receptor domain 0.0097
Further Details:      
 
Domain Number 2 Region: 2027-2216
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000581
Family Vibrio cholerae sialidase, N-terminal and insertion domains 0.055
Further Details:      
 
Domain Number 3 Region: 53-241
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000339
Family C-type lectin domain 0.0088
Further Details:      
 
Domain Number 4 Region: 657-709
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000417
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Domain Number 5 Region: 235-274
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 6 Region: 1744-1794
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 7 Region: 1062-1134
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000113
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number 8 Region: 899-933
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000928
Family EGF-type module 0.027
Further Details:      
 
Weak hits

Sequence:  CBG12386
Domain Number - Region: 1904-1946
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00015
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 1587-1619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000286
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 1942-1982
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000712
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 1403-1432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000909
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 1875-1911
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0011
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 1992-2029
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00139
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 1801-1832
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00168
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 821-931
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00267
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number - Region: 1669-1704
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00358
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 1621-1656
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0127
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 1708-1742
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0158
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG12386   Protein: CBP17436   Gene: WBGene00033343
Sequence length 2855
Comment CBP17436 WBGene00033343 status:Predicted UniProt:A8XFB2
Sequence
MSGKLEIISLEEFDEPFEEILKSEAEEAEKYADKWYGNSIDSWETIRFPNDNIMTILRWF
LQISSFLIILGYCTNPQYYDTEMYSDCFQQAPGWYHLTATCIFPLTQFERNYSTAAQMCG
AVNHSIGYRETNWLIALQLLELFMKEKSRDLMKLYWTGLIVKNDEVIVVESADATDDTMN
VADFTSMYNPLWAEGQPPEDLTSRQLAGSCIALDLRNSSNFGWRALPCSYQLPILCQNYA
CLPGTFRCADNSKCIPSSFQHDGFKDCLDGSDEFVDEVLPISSSTPNSILSSILRVNPIY
EWPMIVSSGGVLSPTTLRYGKGECTHKWTVLSPNDHHFIIWIKWMSPVTSTTIAIEGKDQ
NGRIFLNSRNATSSITLTSSSFLLTASNTDTRKIEFQVHYQDADNSLCKLTERNQLFFNS
ELIPMSCNYHFSTQIPSSYVALLLRKCEGNAPDVATIQFNNMTISLAPRKSKKLLIVPSN
SLNIDVKSSWPDSNTKLDIQFLEIKAGNEEKEDVFLVDTNLEIEWIPRSSEICMSGQFRT
LTVNMIMTSSEDFEGSESVRSTWDVKKFAKSCSEDNVQIVSKNQSAYLTNSSTFSGFGPT
TVVIHQSAEPFEFHSIYSFQETRIEDSGRYFDENNSELESATSFVETTTNQIQSNGICKL
PSVVYGYIMHVSDEMYPIGTIVFIKCNQGYLLSDSASILQCTENGTWEDDNKHTYPSEHP
TVRCLPINCPSQTSVEIEKHLDPDTYETAYGVIRRYLHATNYNFPPFCVCGDSSTSLNSW
KCYDDVEGGILNACILPQTSDAMFLPAGRFVFRSGEPIYMNCMLCNTVIKHYTCEDGLWK
TLEGYVEPYGSFECRCQDESGFQDPCMPYGSYVQHSGFYSCDCINGYKFYNGTCQDRNEC
EEESDFCDDHRYCQNTAGGFTCDCPTNYHLYNASGEDVSHWSKISQWLIDGYSCVETTCV
VKNDWEDKYDIKVIYPPDPSVYYKSGTAMDYLYATNICNSDGYKCVYQFQQSCIQDMWIT
QPNPTMACPVYNLIERNFSYPTDGRPKVFCNAQASWEILPACIYQSCSNITQFITWPLII
QRIDRPLGGRGFEITTVVNLACADGYRMPEGNGAVTCILRGTNYEWAPEIPKCISTSTTS
SYTSSNTAPAATTLTPTAFTFFPFLSSSGTTQSSRDPSTESTWQPTGSEGSFIAYDDVVI
EGSMKFEERSILDQQELWTHSGDWIWTPTGCIIHQWTFPVSFLVTSVPIQLTADQIELLI
DVSQCNSSVQVGVTSSSDGFIPSISDFRPVMNTTSSGSFVVKLKNLKPNLAVSITANGYV
KICGVTIRESVCDEVDYDGLHLKSSKPFSMRRHLSATCTNNQRLPAVNGYCDSRRGWVIQ
KTPCLCETKPICVTPAPIAQFDQVNKCSLNVCQNGECVNTGGGFDCICNAYFIRDIQPNG
DPYCRPNHCELTSQTRNSGYDCDTGLDNDEIKCANVSGYSFYGDFCQYQGSASNNSFIYM
VIRGSENAIATNICDSVDTEYAIPGVRCLVEPTTTPQPHEQSGCNVCVAGNCEYTPPPFD
GGALCICGPGTYGRSCGVSKFCFNETNNHQYLCQNGGTCDLDRRICNCTSMFEGDHCEIA
KDLDTCYGEKDCANGVCHNENGNMYCNCFDGYIPDFYGNCTILWDMCQLNNPCQQGGKCI
FNQTSGEQNCDCSSTGWLGTYCEIQPKVDDCSVCQNSKHCFNNFTLNVRCQCDLGFSGTH
CLDTVNDCNFHPCFNGGKCETFNYIDVQRDLIESYNCTCPTGFSGTNCEIKENPDCSQLI
TCENGGTCSIVSPGSAVCNCTDQFFGTYCEQRCSDQCSHSYGCHESNGTIFCECYDGFSS
PLCDQVDDVCKANVLLCQNSGTCNSTTSECDCPEFFSGTYCETNTDKCQTNSIICENNGS
CVPQSGICECRPNFTGDRCENQIHSCRDITCFNGGTCLESNGTCACIPGSTGDRCQDLGQ
PCIITMPNGSTSPYCLHNGNCTVTENGASCNCDGTDYTGRRCDIKANFNFNLVFNGLGYA
PDIVSKPFFNVSIAQFTICSFVQYNHPAIESNGAQDGSIPTLLPWLIARGYGKSQKIVFD
NKGFFICDPDDTCTRDEPSKRTNYRPTTISANTWHHFCIVSPENLTSPSYTIYLDGVQLL
PQLAPIFNPGPSGYLQLAPPDLTNKTYNRFVGMISMTQLYIIRLNETQIGQLAYDCYTTI
NETSSEIASNTLISWNGGFTRVSSSNPGVFIDPSGICSSVKCMFGRQANSNNYNSTGSCA
KDRISPTVLRCPLNKYVTTSEDFIKVKWSDDEISFFDNIGVVRVEVNYHNGQQFGIGITA
VRYIAFDAAGNSAECTFDVVVVQKACPSESQIFVKGGTIRFGTTRMAPFTSKVAFVECND
KLYPVENRPKFYVCDIMGDFQYGGWLDDTQRKYYLPACGKTVPAEQAINGTVVGDGTCEH
VYRKLYDIIWTSVNCDKIASCHISIRPPCNKTSIGSMADVESGSYALQYTFSTKNATETI
STTVLSQLQTNFTLVRQDSTVDCDPSYPIHDTTGTITTCVSCAEGTFANVTQNQCMECPA
NTYRSSSNPDQLSCTQCPDGTTTGEVTGAFDESQCYKICPIGQYESNGVCLRCPVGTFGP
TEGLQRCICCGFDISTYGDESKTFDDCTKVCDPGQEMIRSADKIEPYCHVCDVGFYKEGS
RGACIQCPRGLITSSKGSKSINDCNVLNCIDANTRRNGNITAGPNTTYSQMCITCEQGTF
QNQTNSDHCIPCTDLSEDAIDVPVTCQSTCSADIPTEGCNCQLQSSGNNSLIIRNCVPEV
KPAHQNSNAIKIVLPIVFGVLLIIVLVVLFCFRKQ
Download sequence
Identical sequences A8XFB2
6238.CBG12386 XP_002639669.1.8413 CBG12386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]