SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG13355 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG13355
Domain Number 1 Region: 193-516
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 7.45e-107
Family Glutaminase 0.00000772
Further Details:      
 
Domain Number 2 Region: 530-626
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000249
Family Ankyrin repeat 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG13355   Protein: CBP26476   Gene: WBGene00034134
Sequence length 662
Comment CBP26476 WBGene00034134 locus:Cbr-glna-2 status:Predicted UniProt:A8XHY8
Sequence
MFPFSTSLFRQNVSFVIFLFIRKTVNLRFFLSFQTQYCSMTTPHTNTTTQKSVMYRIPSE
RTLESLHEMIGSRMSKMSLKNTLRGISNPYERDESEGSEDMIFELFKIPNKNEASIGKLL
TVLRQLGLRDDDPRLVPMMEKIRDFEKIAEEKIAEAKEQKHWKLTKEQFKECIAPSIDIV
SRALQTDMVIPNWINFVEKIRNIYNECKEIKDGQVATYIPQLARQSPHLWAVSLCTVDGQ
RASFGDVKHNFCVQSVSKAFNYAIVASDIGADVVHSYVGQEPSGRLFNEICLDSTNKPHN
PMVNSGAIVITSLIKNKTNMADRFDFVLNQYRKIAGNEYIGFNNATFLSERATADRNYAL
SYFMKENRCFPKETESLTDALDFYFQLCSVEVTCESLAVMASTLANGGVCPITNETCIAP
NPCRDVLSLMYSCGMYDASGQFSFNVRISNFLKKLFKKLQVGLPAKSGVSGAMIVVVPNV
MGLCLFSPPLDTLGNSCRGVAFCKKLVSTFNFHNYDCLVHNSNMKSDPRRRDIRERDRLI
PVFHVARAGDLPTMRRLYMQGEDLNTSDHDDRTVLHIAATEGYETMIKFLVNVAKVDVEK
KDRWGKNALDEAKFFEHTGVARFLEKAMKRPEQHRKDSVSSLDTDDEIDDDGFPEKPCFT
IE
Download sequence
Identical sequences A8XHY8
CBG13355 6238.CBG13355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]