SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG13402 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG13402
Domain Number 1 Region: 99-479
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 3.33e-62
Family beta-Lactamase/D-ala carboxypeptidase 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG13402   Protein: CBP30665   Gene: WBGene00034176
Sequence length 502
Comment CBP30665 WBGene00034176 locus:Cbr-lact-2 status:Predicted UniProt:A8XHU6
Sequence
MATTSTTEITTTEDVVMKTDDDVVVDEGEEEEKTEERKQRQRFLLETGSLQRRLLIYGIA
GILAAVGAWLVLAIAVDNVSILIEGGGMHLDNLVGHVASGYEKVEKVFKRNFADGWEREG
ASITVYHKDRVIVDLQGGYADKASGRKWTPDTRTVVFSTTKAVGAVCVAILVDRGYISYD
DKMSKIWPEFAQNGKENITIDWLMSHRAGLAALDMPISIEDANDFAKMSEVIASQKPNWE
PGTKSGYHAITYGWIVDQIVRRADPQGRSVGRFFKEEVADVHGIDFHIGLPPSEEHTVSR
LSMPSTMHLFREIVHDPRVLIVLAVFNLRPPNSIARKIAANPTWFKLEQDVNTFNNPTLH
AMEQVAALGITKSRDLARLFSLVQQGKLFSKDLLEKFRVPQVQGIDEVVMTPLPKGHGFL
YERHPMSGKKWLVGHPGYGGSTIMMDLDDGITIAYVSNGLKTGMGELTRTYRHLRDAVFE
CLEKQKNGASVFIEDAVQAVAA
Download sequence
Identical sequences A8XHU6
6238.CBG13402 CBG13402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]