SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG13447 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG13447
Domain Number 1 Region: 660-975
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.62e-71
Family Protein kinases, catalytic subunit 0.0000000717
Further Details:      
 
Domain Number 2 Region: 30-209
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.36e-43
Family Ephrin receptor ligand binding domain 0.00052
Further Details:      
 
Domain Number 3 Region: 340-528
Classification Level Classification E-value
Superfamily Fibronectin type III 2.56e-23
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 4 Region: 237-337
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000738
Family Growth factor receptor domain 0.0055
Further Details:      
 
Weak hits

Sequence:  CBG13447
Domain Number - Region: 1017-1072
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00017
Family SAM (sterile alpha motif) domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG13447   Protein: CBP03296   Gene: WBGene00034210
Sequence length 1118
Comment CBP03296 WBGene00034210 locus:Cbr-vab-1 status:Predicted UniProt:A8XHR0
Sequence
MRLYNSRILNPFYSIFLLQLFVIEFVNSHQEVLFDLSKATPATRWDSLALKHDRDDVWME
ETWRNPAATDEKHANQRAYVTCNYDMDQPSNWLFSHFIEVQSARRIYVELLFNIRDCLGF
TDPKSCKETFTVFLKQLKTSHPGSAKIEREQFAKDMKNWQNIGRMARSNSNTTTETIGFE
IEPDTKMIRIAFEEQGICLSLLNVKIYYRVCDEFTDQLVQFPAQVTGAKETDMVRMNGTC
IPNASRKIAGVDLIGLCMATGSAIKTSGECVCDSGYSEIADSNGARCESCPPNTYKPKGQ
SMCKPCPANSVSGEAASSCRCVNGYFRADDEMVSQSCTQPPSRPIKLVANAITATSTRLS
WNEPSSLGGRPEIWYEVRCSGRGECGSVVMTPSDKRLSTRSIQINGLRPSSDYTFLVFAK
NKVSGELAEFSEKSAVIDIRTRSEEEDVPPVTHLRVDASQSDGITIAWSVSDSDIHDFEV
EVRPAIVKKRAFETRHVNQTYTTFIGLRHDTVYQFRVRVKDDLRWSSPISYQLGKGLLSS
SSSTSEEDTQFLNQTGSALLIIIALILVVIAIALCMIVVQKKTKNRKQMSDLDVLDTYKQ
DSMTPDYHTTSRHHHHQGNLPANLHEQLRSTTKLNAPLIPSFGSPISQPPPYYGGVHTNS
GKYKTYVDPTTYEDPYQALIEFTFDISPNDVFITQVIGGGEFGDVCLGGLSRNSPAAAKW
NVASTMARGFESEQYETVAIKTLKSGSSAKAKAEFLTEATIMGQFSHPNVIRLIGVVTSS
EPVMIISEYMVNGSLDQYLRNADQRGDKVHWEKITEMLYGIASGMKYLTDMGYVHRVSWI
SDLAARNVLLDHELRCKIADFGLSRGVRSEGSSIEPEYTTNGGKIPVRWTAPEAITHRKF
TPSSDVWSFGVVIWEVCSFGERPYWDWTNQKVISEVMIGYRLPPPMDCPMGLYRIAQWCW
KMERHERPTFTQLLAAFHKYILQPTLIETDPGELPRRVMSQAALNSMNPSYGSVSMPTPP
SSAAPMPSLDDFLRQIGLNHVYGKLVSNNIHSVSDLANTSHLDLLACGLISPECSIVRDG
LNGRIVTSSGSPGNSSGTLHATTRGTRTTRPREEGFFV
Download sequence
Identical sequences A8XHR0
6238.CBG13447 CBG13447 XP_002630069.1.8413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]