SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG13693 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG13693
Domain Number 1 Region: 726-1180
Classification Level Classification E-value
Superfamily ARM repeat 4.68e-63
Family Plakophilin 1 helical region 0.0000151
Further Details:      
 
Domain Number 2 Region: 237-433
Classification Level Classification E-value
Superfamily Fibronectin type III 3e-31
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 3 Region: 460-654
Classification Level Classification E-value
Superfamily Fibronectin type III 3.49e-24
Family Fibronectin type III 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG13693   Protein: CBP32855   Gene: WBGene00034421
Sequence length 1296
Comment CBP32855 WBGene00034421 locus:Cbr-jac-1 status:Predicted UniProt:A8XIH7
Sequence
MMTSGWMQEMEPIPEEGTEADGSEWGGATSEGGGPGRRTLRKKEVYTSEQINTLVRYVWL
SISSRRIGDPFLKNQFFFQFQYSYFFSTVPKESVPQEWLVENQVVDPEMATSYLTESLAG
PTSARGSSYSYSYESHYDNPPEEEYEHFTNDDGVHQMQKVTRVTKVTTTRSVRQVPVQSP
YSNIDFDSSGLPTPSPVIDRDPSLEMMARMGNGHDSEDRAAPPPAPHGRFMHEDSGIPSA
PGVPDVIDAGIGEVTVVWSAPLQKNGGEIRGYQLQMRELPDGEWEDMGVDQLIKDTSCRV
TNLTSHEVQFRVSAYGRTGFGPTSNPSLPVKIPISENDLATSAGAPLAPGRPTVIAVDGQ
GVLLEWTAPIADVHSSPPQGYQVEYRVYGSRDWMIANEQLVQDTMFTVESLRPNGVYEFR
VRGKNQDGLGHPSLSSGGVAIRPAAPQRNLPARKVSESVNPPGQPQMVEAGDDWVKLEWA
PSAEQAGYIVEYREVGDPTWHTANYDPIVQNGIQVEGLRRNSTYEFCVISVMDNLYSHPS
ETSDIIHLRPMGRASSLRVVPELAEAPEFLDVDGDKITICWLPAHSQLPVIGYDVEFRDL
QQDDRWYKVNDQPVFACKMTVGDLILDHDYQFRVLAHNASGCSQPSPPSQFVHIEPSTHR
LSAQTLDSPNLGHHDIVKYVEAERFGAVPLLQEEMVRESPPLPERDDSPPPLRRANNNVQ
WRDPSLKEVIEYLSSADKDKQLNASGYLQHLTYSDNLIKEETRELGGIPKLIALLRSDTP
RIQKNACACLKNLSYGKENDANKMAVMEADGVRQLSEVLRTTHDASVKEEATAALWNLSS
ADMLKPVILESATEILSQQVMAPLFSGQGSAASDPSRHFGSTLFKNSTGILRNVSAASQA
ARRRLRDVPNLIEALVHFLTHSIQKNQVDTPTVENAVCLLRNLSYRIQEVVDPNYDPAAA
HVNSKNMKHAASPKPKKKEKESKKKDSKKNPKNIVTGPSLLWQPHVVKLYLKLLQDSSNI
ETLEASAGAIQNLAACQFPPSAEVRAAVRVEKGLPVLVELIRLPEDFVVCAVATALRNLA
IDPRNRELIGKYALRDFLEKLPEPGTPRRSAVSDQTIAAVLGILFEIVRSSAAYTKDVHE
LKGTDKLRFLSRNYPTYSHRVARYASQVLYVMWQHKELQDGFKRSGLKEADFCSLGPRKG
DSSTLARPISSQGRERPSMHNLDETLSSGGGYGTMDHHHRSTVTPNSANRPASATSQTIQ
RRYDQVPNSGGPVYASVQKQPSPRGGNGNNVDDSWV
Download sequence
Identical sequences A8XIH7
6238.CBG13693 CBG13693

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]