SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG14221 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG14221
Domain Number 1 Region: 685-873
Classification Level Classification E-value
Superfamily Fibronectin type III 1.44e-25
Family Fibronectin type III 0.0012
Further Details:      
 
Domain Number 2 Region: 224-319
Classification Level Classification E-value
Superfamily Immunoglobulin 1.66e-24
Family I set domains 0.0049
Further Details:      
 
Domain Number 3 Region: 554-653
Classification Level Classification E-value
Superfamily Fibronectin type III 7.78e-23
Family Fibronectin type III 0.0003
Further Details:      
 
Domain Number 4 Region: 448-539
Classification Level Classification E-value
Superfamily Immunoglobulin 4.03e-22
Family I set domains 0.0062
Further Details:      
 
Domain Number 5 Region: 133-231
Classification Level Classification E-value
Superfamily Immunoglobulin 1.89e-21
Family I set domains 0.0067
Further Details:      
 
Domain Number 6 Region: 313-410
Classification Level Classification E-value
Superfamily Immunoglobulin 3.79e-19
Family I set domains 0.025
Further Details:      
 
Domain Number 7 Region: 28-122
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000128
Family I set domains 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG14221   Protein: CBP34252   Gene: WBGene00034790
Sequence length 1295
Comment CBP34252 WBGene00034790 locus:Cbr-sax-3 status:Predicted UniProt:A8XJJ4
Sequence
MFNRNVQLCSFLLVLNTAVFCEDTSNLAPVIIEHPLDVVVSRGSPATLNCGAKPSTAKIT
WYKDGQPVITNKEQVNSHRIVLDTGSLFLLKVNSGKNGKDSDAGAYYCVASNEHGEVKSN
EGSLRLAMLREDFRVRPRTVQALGGEMAVLECSPPRGFPEPVVSWRKDDKELRIQDLPRY
TLHSDGNLIIDPVDRSDSGTYQCVANNMVGERVSNPARLSVFEKPKFEQEPKDMTVDVGA
AVLFDCRVTGDPQPQITWKRKNEPMPVTRAYIAKDNRGLRIERVQPSDEGEYVCYARNPA
GTLEASAHLRVQAPPSFQTKPVDQSVPAGGTATFECALVGQPSPAYFWSKEGQQDLLFPS
YVSADGRTKVSPTGTLTIEEVRQVDEGAYVCAGMNSAGSSLSKASLKVTTKGMRCNTPTS
KKNDLNNKKCHVSKSIFSAVTGNTPAKPPPTIEHGHQNQTLMIASSAILPCQASGKPTPG
ISWLRDGLPIDTTDSRISQHSTGSLHIADLKKPDTGVYTCIAKNEDGESTWSASLTVEDH
TSNAQFARMPDPSNFPSAPTQPIIVNVTDTEVELRWNAPSTSGAGPITGYIIQYYSPDLG
QTWYNIPDYVATTEYRIKGLKPSHSYMFVIRAENEKGIGTPSVSSALVTTGKAAAQVALS
DKNKMDMAIAEKRLTSEQLIKLEEVKTINSTAVRLFWKKRRVEELIDGYYIKWRGPPRTN
DNQYVNVTSPSTENFVVSNLMPFTNYEFFVIPYHSGVHSVHGAPSNSMDVLTAEAPPSLP
PEDVRIRMLNLTTLRISWKAPKADGINGILKGFQIVIIGQAPNNNRNITTNERAASVTLF
HLVTGMTYKIRVAARSNGGVGVSHGTSEVTMNQDTLEKHLAAQQENESFLYGWINKSHVP
LIVIVALLIIFVVIIIAYCYYRNSRNMDGKDRSFIKINDGSVHMAANNLWDVAQNQNQMY
NTTGRMTMNNRNGGGQALYSLTPNAQDFFNTCDDYSGTMHRPGSEHHYHYAQLTGGPGNA
MSTFYGNQYHDDPSPYATTTLVLSNQQPAWLNDKMLRAPAMPTNPVPPEPPARYADQTAG
RRSRSSRASDGRGTLNGGLHHRTSGSQRSDSPPHTDVSYVQLHSSDGTGSSKERTGERRT
PPNKTLMDMMPPPPSNPPPPGSHVYDTATRRQLNRGSTPREDTYDSVSDGAFARVDVNAR
PTSRNRNLGGRPLKGKRDDDSQRSSLMMDDDGGSSEADGENSEGDVPRGSGVRKNVPRMG
ISASTLAHSCYGNNGTSQRFRSIPRNNGIVTQEQI
Download sequence
Identical sequences A8XJJ4
CBG14221 6238.CBG14221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]