SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG14255 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG14255
Domain Number 1 Region: 28-65
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000209
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 2 Region: 111-147
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000563
Family LDL receptor-like module 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG14255   Protein: CBP34388   Gene: WBGene00034816
Sequence length 1782
Comment CBP34388 WBGene00034816 status:Predicted UniProt:A8XJM0
Sequence
MLTVFLYLVVFPIFAFSQFLSYDAIRMRVPGRCMSGDYDCGLGQCVPISQFRDGKPDCMD
GSDEWCFIGQVSCGPVYCADYKDAFPCILYPKCDGSTKQLPWCSASKEKLCADKTSFPCK
GYGECVLWEWLLDGKKDCIDGSDEDENYVMPLEHAYRCARNQTGLFLPKPIPPPPEDHPS
LYVEGCSMCSKPPASLVPSTSISSEGTMDHTTPKYPFITSSPSGNTQPPLSNFPIFPNEQ
ETRPGDFFSVNVPSGVEISRVTSSQKPNEPIGEFFPSHSSTPLPPLTDATTQSHTFRLIT
IPSISQTQFPQAPLIFPGRPDLPPITAAPSPLNNWPIPIVTTTPDSHHQGPLPPITYPTI
EEGGSAKIPPIRPGIIISRPVTPKKPVDLPEDDDDYYGDRGGGGSPPGINPFDLPTRPPA
TFAPSVFQTAGPVGFRPITKPSEEPVENESGYGESPNKGIVDTLVPLISGRVLPSIPTRR
PLTIPSYFTSPPSPHFPNMPEYHTTRPTGGMLPTLIPQTEVDKYLQTQIPSLKPGATRKP
EGFIEEKPLTPQPTHSPEVPGPGTSEKEEVDQESSKATTTRSKIIHVGPNGVVEENEKNL
PGSDREGVRSGTGIESGTESVTGSDKIIHIGPTVQTTQSTLEPSSSSTASSSSEASTVSS
STLQTTTVKTGDPKIDECLSKMSDSGTYVVCDCPNGQLRNSGTGNCEGKSLSHTSKLIVV
DSETLSLMNIKVNVGTICNTDKASFEQKQRILHQKKKSSQIAQSYRSCIRSSEHENALIA
TIDCKECDVQEVNRLITTRSFGEPGTLNVTAEGDFEIRSFLKVIFSALGSSLCSDSDFNH
CHVYSDCVIDNENLRYACRCKKGTTDTSEGYGRTCEGFPEESDCILILGICLIVWLLFLL
GTLMLSLLFCILCYALCRNRCCRQIAIHPANADGLQTVVIGPKAAKSLDPNRERLPHMKA
IFAESLKHSAKGSTSVASAFALADFRRKKVSRPPDMSQVIEETAEFPVPKLSTSESMPKV
NSLAKLSTNSEPPTPVGVIETPILEKNSSSVSLVSANDNAPQLPSLPLPLPVPITTNAST
TNLEDAGSSNEKRAGSAPHEQHVPEAERPASSHSIGVQPTIWETYRVLGQQYSKSDLTER
KPSVDSLEQMFEARLAETARTAKTIPTVRTEKSDTSAITFTAKPNKEKTDEPPPTVSKEG
KTLPNPSETKEEKAAAVAEQIEHNLEEQEETKLKETDSKLADMIGVTNFHTSKDVSPSRP
DSGEGPSKEPVAPWVLVEDRPIADTLEKSLEAALLVEMAKRGIELPLSPKSDTPLVKDLE
KVVIDPASQVIKPAAPVDPAEDSDIIPVPPKKPETPKKPESRKSSAKPMSASSRRSKIPS
TSHSRVGSAKQIGEQDNEEPEVFVPLGAKTILQDKKRLLRRSGGAGGSELIPSTDESDPE
IAFFKRLEKMKQDPMRYPVHPYRKYVRRRRPERTLSSISEKSAEIAAEAALEYPQDTSIS
CPPTTRAFLEAPPPPRPRYNFRRKVIEAADETSDVDLPRLSPARHPHPVVSSPEIPDVTL
QRSMENLHKTEMKNTKPPFHPQTPTKKSALLKKKPSKSGSAAPSASSIHSSRHSSKFASK
ATTPRGDETPSSLTSRSTRHSVISRKIAIRRQELKAVTGSARDLSCSRINSRVTPTHALR
AAKSVGDLSKPLKPNWDISPYRDTPGPSTFLPPITPSRGGARTTLTSPQPRHRRSDSHFS
NTSLPLISHSPTSFWSSPYFNPSEDTKKPPKEDLWWNPNKRM
Download sequence
Identical sequences A8XJM0
CBG14255 6238.CBG14255

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]