SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG14320 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG14320
Domain Number 1 Region: 330-426
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000118
Family Fibronectin type III 0.0063
Further Details:      
 
Domain Number 2 Region: 154-308
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000345
Family Fibronectin type III 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG14320   Protein: CBP03535   Gene: WBGene00034863
Sequence length 483
Comment CBP03535 WBGene00034863 status:Predicted UniProt:A8XJR7
Sequence
MRLHSSILILLCTTNLVISFVVLPYIQIDYAHLIRVAHCKAKCSEKYGYPKTRENLDGSI
DEYFFVDTEEYSKCENGCLQFQHRRDMKRSNLTGETLQGAKFWLESTAHSGKVGSSPVST
IELLCQMPSATPDLDDSFEGLLGLTKVRPSGPVQYVVQWKQRTYALGYYDESQWITASVE
SDGMIKVDGMIPGVQYKFLVTVVGPAGKLGDTIQSEWTEISNTLTVKAPGAPLIVKNGFN
SEQGVVAHLHFPRTAYDSCYFRLQVKNATNSVVSDLRVDPTYSILLSHLEFDSSYAVTLS
ALSSDQNTATNPISVRFNSFQCKQVYGKGSLQCAPEPVSNIRVAIEANSTAQITWTASAE
PENILTYAITYQAYLGPCNKDPTTVYLGAPSTSYEMLLPRNVHCEFMFRITNYDAIGREA
FAETRIAVMQERLISSSFTVPLIAIGISFAFLILAVCCFAVCRCCNKCPVKVSENKAKLT
DYA
Download sequence
Identical sequences A8XJR7
CBG14320 6238.CBG14320 XP_002644454.1.8413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]