SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for CBG14788 from Caenorhabditis briggsae 2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  CBG14788
Domain Number 1 Region: 304-391
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000302
Family Fibronectin type III 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GBrowse: CBG14788   Protein: CBP03464   Gene: WBGene00035183
Sequence length 403
Comment CBP03464 WBGene00035183 status:Predicted UniProt:A8XKP0
Sequence
MKSKRSFIRAILFVLRLQKNVNVRRNQSRRNTIFTSRNITRFLQLLYSFRGRKESYRDAN
LPSTAVAHRTKVPNVTGTVHRAARTHSGLFICYVISCWFFSGSPSVIRASFLDNHHNQQD
NLCDFGAFSAMSQPYLVGLDDSRGRPLISVCAGAAHTLASTALLCRQQSLDEPATRALEK
VASGPLLRGISVQRQSSVEFSERRRAEDAQKLQKKAIKTNMISMFGAIIACEQNDVEALK
VVIDKNQFDVTSAVNGNYEAYPTKWSLLDIAINLNNDHDKRMSSLQIHLSLLKQMEDFLE
KTVKPKMLQSVSVEAISHSRALIQFNYKEPQPSIVLKFKIQWSDTEDFKTVIGEIIEPRP
LENRIIIHNLEHGKHYFFTISCIGVNGESKPMVCWPGRIEITS
Download sequence
Identical sequences A8XKP0
6238.CBG14788 CBG14788 XP_002644775.1.8413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]